COPE Media Kit


Cope Home
Previous entry:
Intestinal peptide PHV-42
Next entry:
intestinal trefoil factor
Random entry:
FFGVGGEEDITVQTVTWPDMELPLPRNITEGE
Search COPE:

intestinal subepithelial myofibroblasts

[intestinal subepithelial myofibroblast]

abbr. ISEMFs. These cells are myofibroblasts found in a subepithelial location throughout the gastrointestinal tract from esophagus to anus and in the gallbladder and pancreas. They may transdifferentiate from resident fibroblasts or smooth muscle cells (Powel, 1999).

Intestinal subepithelial myofibroblasts exist as a syncytium with fibroblasts and mural cells in the lamina propria of the gut (for reviews see: Powell, 1999; Powell et al, 1999; Powell, 2005). This syncytium extends throughout the lamina propria of the gut, merging with the pericytes surrounding local blood vessels ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: March 2011



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=27703