Intestinal peptide PHV-42 |
intestinal trefoil factor |
FFGVGGEEDITVQTVTWPDMELPLPRNITEGE |
||
[intestinal subepithelial myofibroblast]
abbr. ISEMFs. These cells are myofibroblasts found in a subepithelial location throughout the gastrointestinal tract from esophagus to anus and in the gallbladder and pancreas. They may transdifferentiate from resident fibroblasts or smooth muscle cells (Powel, 1999).
Intestinal subepithelial myofibroblasts exist as a syncytium with fibroblasts and mural cells in the lamina propria of the gut (for reviews see: Powell, 1999; Powell et al, 1999; Powell, 2005). This syncytium extends throughout the lamina propria of the gut, merging with the pericytes surrounding local blood vessels
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |