COPE Advertising options



Previous Next
Search COPE:
 


- N -

Select one of the following:


n

N-(1-benzylpiperidin-4-yl)-6,7-dimethoxy-2-(4-methyl-1,4-diazepan-1-yl)quinazolin-4-amine
N1L protein
N1 neutrophils
N1R
N1 TANs
N1 tumor-associated neutrophils

N2L protein
N2 neutrophils
N2 protein
N2 TANs
N2 tumor-associated neutrophils

N5

N-9F-proliferation factor

N51

N73 protein

N521J

N901

Na1
NA1
NA1/NA2
NA2
NA1/34
NAALAD1
NAALADase
NAALADase 1
NAC
N-Ac-DEVD-N'-MC-R110
N-acetylated-alpha-linked acidic dipeptidase
N-acetylated-alpha-linked acidic dipeptidase 1
N-acetyl-D-glucosamine 2-epimerase
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
N-acetylmuramoyl-L-alanine amidase
N-acetyl-proline-glycine-proline
N-acetyl-seryl-aspartyl-lysyl-proline
NACHRA7
NACHT domain
NACHT domain Leucine-rich repeat and PYD-containing protein 1
NACHT domain Leucine-rich repeat and PYD-containing protein 2
NACHT domain Leucine-rich repeat and PYD-containing protein 3
NACHT domain Leucine-rich repeat and PYD-containing protein 4
NACHT domain Leucine-rich repeat and PYD-containing protein 5
NACHT domain Leucine-rich repeat and PYD-containing protein 6
NACHT domain Leucine-rich repeat and PYD-containing protein 7
NACHT domain Leucine-rich repeat and PYD-containing protein 8
NACHT domain Leucine-rich repeat and PYD-containing protein 9
NACHT domain Leucine-rich repeat and PYD-containing protein 10
NACHT domain Leucine-rich repeat and PYD-containing protein 11
NACHT domain Leucine-rich repeat and PYD-containing protein 12
NACHT domain Leucine-rich repeat and PYD-containing protein 13
NACHT domain Leucine-rich repeat and PYD-containing protein 14
NACHT domain Leucine-rich repeat and PYD-containing protein 15
NACHT domain Leucine-rich repeat and PYD-containing protein 16
NACHT, LRR and PYD domains-containing protein 15
NACHT, LRR and PYD domains-containing protein 16
NACHT-LRR-PYD-containing protein-1
NACHT-LRR-PYD-containing protein-2
NACHT-LRR-PYD-containing protein-3
NACHT-LRR-PYD-containing protein-4
NACHT-LRR-PYD-containing protein-5
NACHT-LRR-PYD-containing protein-6
NACHT-LRR-PYD-containing protein-7
NACHT-LRR-PYD-containing protein-8
NACHT-LRR-PYD-containing protein-9
NACHT-LRR-PYD-containing protein-10
NACHT-LRR-PYD-containing protein-11
NACHT-LRR-PYD-containing protein-12
NACHT-LRR-PYD-containing protein-13
NACHT-LRR-PYD-containing protein-14
Nackt
N-ac-PGP
N-acyl-D-glucosamine 2-epimerase
NAD+ ADP-ribosyltransferase
NAD+-dependent isocitrate dehydrogenase 3 gamma-like
NADE
NADE2
NADE3
NADE4
NADE5
NADH-cytochrome b5 reductase 3
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
NADH dehydrogenase (ubiquinone) flavoprotein 3
NADH-diaphorase-1
NADH-ubiquinone oxidoreductase B16.6 subunit
NADH-ubiquinone oxidoreductase subunit V3
NAD(P)H quinone dehydrogenase 1
Naegleriapore A
Naegleriapore B
Naegleria pore-forming protein
Naegleriapores
NA-ergic neurons
NAF
Naf1
Naf1-alpha
Naf1-beta
NAG-1
NAG14
NAGE
NAGIF
NAGly receptor
NAGSLLSGWG
NAIF1
NAIL
NAIP
NAIP1
NAIP2
NAIP3
NAIP4
NAIP5
NAIP6
NAIP-rs1
NAIP-rs2
NAIP-rs3
NAIP-rs4
NAIP-rs5
NAIP-rs6
naive B-cells
naive cells
naive embryonic stem cells
naive pluripotency
naive pluripotent stem cells
naive state stem cells
naive stem cells
naive T-cells
NAK1
Na+/K+ ATPase beta 3
Naka blood group antigen
NAKLYPMPRVamide
NAKLYPVPRVamide
NALP1
NALP1L
NALP1S
NALP2
NALP3
NALP4
NALP5
NALP6
NALP7
NALP8
NALP9
NALP9a
NALP9b
NALP9c
NALP10
NALP11
NALP12
NALP13
NALP14
NALP-delta
NALP family
N-alpha-(N-acetylmuramyl-L-alanyl-D-isoglutaminyl)-N epsilon-stearoyl-L-lysine)
N-alpha-PGP
NALP-theta
NALP-zeta
NALSMPRNKCNRALMCFG
NALSSPRNKCDRASSCFG
Namalwa
Namalwa BCGF
Namalwa B-cell growth factor
Namalwa interferon
NamiRNAs
NAMLAA
NAmPRTase
NAMPs
Nampt
NAMSD
NANC neurons
NA neurons
nanoerythsosomes
NANOG
NANOG1
NANOG2
NANOG homeobox pseudogene 1
NANOG homeobox pseudogene 2
NANOG homeobox pseudogene 3
NANOG homeobox pseudogene 4
NANOG homeobox pseudogene 5
NANOG homeobox pseudogene 6
NANOG homeobox pseudogene 7
NANOG homeobox pseudogene 8
NANOG homeobox pseudogene 9
NANOG homeobox pseudogene 10
NANOGP1
NANOGP2
NANOGP3
NANOGP4
NANOGP5
NANOGP6
NANOGP7
NANOGP8
NANOGP9
NANOGP10
nanophthalmia 4
nanophthalmos-4
N antigen
Naofen
nanovesicles
NAP
nap
NAP-1
Nap1
NAP-2
NAP-3
NAP-4
NAP4
NAP-22
NAP125
NAP-2(50-70)
NAP-IF
NAPOR
NAPOR-1
NAPOR-2
NAPOR-3
NAPP-19
NAP peptide
NAPPEPVPPPRAAPAPTHV
NAP S
napts
NAPVSIPQ
N-arachidonyl glycine receptor
NARC1
Nardilysin
nardilysin 1
nardilysin 2
NARG1
N-Arg dibasic convertase
N-arginine dibasic convertase
NARP
narrow arbor cells
narrow arbor interneurons
narrow arbor neurons
narrow cells
narrow-field amacrine cells
narrow-field cells
narrow-field ganglion cells
narrow-field neurons
narrowminded
narrow-spiking neurons
NARS
Nartograstim
NASG
Nasopharyngeal carcinoma-associated gene 14
Nasopharyngeal carcinoma-related protein
NAT1
Nat1 homolog
NAT26
Natalisin
Natalisin-1
Natalisin-2
Natalisin-3
Natalisin-4
Natalisin-5
NATFYFKIDNVKKARVQVVAGKKYFI
NATH
National Institute of Allergy and Infectious Diseases
National Institute for Biological Standards and Control
native Alpha-2-Macroglobulin
native CRP
Natively unstructured proteins
nat-microRNAs
nat-miRNAs
natriuretic peptide precursor type A
natriuretic peptide precursor type B
natriuretic peptide precursor type C
natriuretic peptide receptor 1
natriuretic peptide receptor 2
natriuretic peptide receptor 3
natriuretic peptide receptor A
natriuretic peptide receptor B
natriuretic peptide receptor-C
natriuretic peptides
Natriuretic peptides A
Natriuretic peptides B
Natriuretic peptides C
NATs
nat-siRNAs
natural antisense microRNAs
natural antisense siRNAs
natural antisense small interfering RNAs
Natural antisense transcripts
Natural Born Killer
Natural cytotoxic cell growth factor
Natural cytotoxic factor
natural cytotoxicity receptor 1
natural cytotoxicity receptor 2
natural cytotoxicity receptor 3
natural cytotoxicity receptors
natural cytotoxicity triggering receptor 3 ligand 1
natural helper cells
natural IFN-producing cells
Natural killer cell activating factor
Natural killer cell activity-augmenting factor
natural killer cell group 7 sequence
natural killer cell lectin-like receptor 2A
natural killer cell lectin-like receptor 2B
natural killer cell lectin-like receptor 2C
natural killer cell lectin-like receptor 2D
natural killer cell lectin-like receptor 2F
Natural killer cell Met-ase
Natural killer cell p30-related protein
Natural killer cell p30-related protein-A
Natural killer cell p30-related protein-B
Natural killer cell p30-related protein-C
Natural killer cell p44-related protein
Natural killer cell p46-related protein
Natural killer cell p65-related protein
natural killer cell protein 7
natural killer cell receptor 2B4
natural killer cell receptor P1
natural killer cell receptor P1A
natural killer cell receptor P1B
natural killer cell receptor P1C
natural killer cell receptor P1D
natural killer cell receptor P2
natural killer cell receptor P1.9
natural killer cells
Natural killer cell stimulatory factor
Natural killer cell stimulatory factor-1
Natural killer cell stimulatory factor-2
natural killer cell transcript 4
Natural killer colony-inhibiting activity
Natural killer cytotoxic factor
Natural killer DCs
Natural killer dendritic cells
Natural killer enhancing factor
Natural killer enhancing factor A
Natural killer enhancing factor B
Natural killer leukocyte chemotactic factor
natural killer-like B-cells
natural killer-like T-cells
Natural killer lysis resistance inducing factor
natural killer protease-1
natural killer protease-4
Natural killer resistance inducing factor
natural killer T-cells
naturally occurring cell death
natural regulatory T-cells
Natural suppressor cell-derived suppressor factor
natural suppressor cells
NAV1
NAV2
NAV3
NAVPITPTL
NAWGPWSKEQLSPQA
NAZC

NB1
NB1 glycoprotein
NB1 gp
Nb2
NB41-derived endothelial cell growth factor
NB41-ECGF
N-BAK
N-BAR domain
NBCF
N-benzoyl-L-tyrosyl-p-aminobenzoic acid hydrolase
NBFL
NB-GF
NBK
nbl
NBL1
n blast cells
N blood group antigen
NBN
NBNT-cells
NBS1
NBS-LRR proteins
NB-thymosin-beta
N-butyloxycarbonyl-MDGCEL

NC1
NC1[alpha3(IV)185-191]
NC1[alpha3(IV)185-203]
NC1 domain
NC28
NC30
NCA
NCA-50
NCA-55
NCA-90
NCA-95
NCA-100
NCA-160
NCA-50/90
NCAD
N-cadherin
N-Cad90
NCAM
NCAM1
NCAM2
NCAM21
NCAM-120
NCAM-140
NCAM-180
NCAM(504-516)
NCAM(515-531)
NCAM(529-544)
NCAM(545-559)
NCAM(561-573)
NCAM(573-586)
NCAM(589-599)
NCAM(631-645)
NCAM BCL peptide
NCAM FGF receptor activation motif peptide
NCAM FG loop peptide
NCAM FRM peptide
NCAM-H
NCAM-L
NCAML
NCAM L1
NCAM mimetics
NCAMP-1
NCAM-related tyrosine kinase
NCBP2 antisense 2
NCBP2 antisense RNA 2
NCBP2AS2
NCC1
NCC2
NCC3
NCC4
NCC antimicrobial protein-1
NC cell growth factor
NCCF
NCCs
NCD
N cells
NCF
NCK
NCK1
NCK2
NCK adaptor protein
NCK adaptor protein 1
NCK adaptor protein 2
Nckalpha
NCKAP1
NCKAP1L
Nck-associated protein-1
Nck-associated protein-1-like
Nck-associated protein 125 kDa
Nck-associated protein-4
Nckbeta
NCK interacting protein with SH3 domain
NCKIPSD
NCL
NCL-2
nCLU
NCP
NCP92
NCP[1-76]
NCP[7,8-76]
NCR
NCR1
NCR2
NCR3
NCR3LG1
NCR3 ligand 1
NCR22 cells
ncRNAs
nCRP
NC-specific cytotoxic factor

ND10 domains
NDAP
Ndap7
NDAP7
NDBP-5
NDBP-2.8
NDBP-3.4
NDBP-4.1
NDCF
NDDCELCVNVACTGCL
NDED
NDF
NDF-alpha
NDF-beta
NDGs
NDH2
NDHII
NDLCF
NDN
NDNF
NDNs
NDP
Ndph
NDPKA
NDPKB
NDP kinase
NDP kinase 6
NDP kinase 7
NDP kinase A
NDP kinase B
NDP kinase B(2-16)
NDPP-1
NDRG4
NDRG4-B
NDRG4-H
NDSP
NDUFA13
NDUFV3

N-[(E)-2-(2,5-dihydroxyphenyl)ethenyl]formamide
Nea blood group antigen
NEB
Neb-colloostatin
Neb-myosuppressin
Neb-PVK-1
Neb-PVK-2
nebrodeolysin
nec
Nec-1
Necdin
neck cells
Necl-5
necrapoptosis
necrocrine
Necroinflammation
necroptosis
necroptosome
necroptotic bodies
necroptotic cells
necroptotic damage-associated molecular patterns
necroptotic DAMPs
Necrosin
necrosis
necrosis-like cell death
necrosome
Necrostatin-1
necrostatins
necrotic cell death
necrotic cells
necrotic protein
necrotic pyknosis
necrotoxigenic Escherichia coli
necrotoxigenic Escherichia coli type 1
necrotoxigenic Escherichia coli type 2
Nectadrin
Nectin
Nectin-1
Nectin-1-alpha
Nectin-1-delta
nectin-2
Nectin-2-alpha
Nectin-2-delta
Nectin-3
Nectin-3-alpha
Nectin-3-beta
Nectin-3-gamma
Nectin-like molecule-5
NEDD2
NEDD2-like caspase
NEDF
NEF
NEFA
Nef-associated factor-1
Nef-associated factor-1-alpha
Nef-associated factor-1-beta
Nefisin-1
Nefisin-2
NEF peptide
Nef protein
negative acute phase reactants
Negative chemotaxis
Negative growth factors
negative guidance cues
Negative Regulator of Haematopoiesis
Negative regulatory protein
NEGF-1
NEGF-2
neglect-induced death
NEGR1
NEI
NEI-MCH
Neisseria gonorrhoeae opacity-associated protein interacting protein-3
Neisseria meningitidis hia/hsf homologue A
Nel
NEL-GF
NELL-1
NELL-1-ΔE
NELL-2
NEL-like 1
NEL-like 2
NEL-like Molecule 1
NEL-like protein 1
NEL-like protein 2
Nel-related protein 1
Nel-related protein 2
Nematocin
nematocytes
NEMO
nemosis
NendoU
NENF
NEO1
Neobellieria bullata colloostatin
Neobellieria bullata myosuppressin
Neobellieria bullata periviscerokinin-1
Neobellieria bullata periviscerokinin-2
neoblasts
neoblast stem cells
neocasomorphin-6
neoCRP
neocytes
neocytolysis
Neoendorphins
Neogenin
neogenin-1
neohepatocytes
NeoHep cells
Neokyotorphin
neokyotorphin(1-4)
neomorphic moonlighting functions
neomyosuppressin
Neonatal brain-derived carcinostatic factor
neonatal-onset multisystem inflammatory disease
neoplastic colony-forming units
neoplastic stem cells
neosis
neosis mother cells
neostatin
neostatin-7
neostatin-14
neosulfakinin I
neosulfakinin II
neosulfakinins
Neovascularization
Neovastat
NEP
NEP1-40
NEPH2
nephrin-like-2
nephroblast growth factor
Nephroblastoma overexpressed gene
nephroblastostatin
Nephrocan
nephrocan pseudogene
nephrocytes
Nephronectin
Nephropontin
NEPMUCIN
Nepn
NEPNP
neprilysin
NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK
NepYR
N-ERC/mesothelin
NERP-1
NERP-2
NERP-3
NERP-4
nerve cells
nerve/glial antigen 2
Nerve growth factor
Nerve growth factor-alpha
Nerve growth factor-beta
nerve growth factor family
Nerve growth factor-gamma
Nerve growth factor-2
Nerve growth factor-inducible
Nerve growth factor-inducible A
Nerve growth factor-inducible B
Nerve growth factor-inducible C
nerve growth factor-inducible large external
nerve injury-induced protein
nerve injury-induced protein-1
nerve injury-induced protein-2
nerve sheath cells
NES
NESCA
nesfatin
nesfatin-1
nesfatin-1 neurons
Nesidioblasts
NESP
NESP55
NESP55(159-162)
NESP55(163-166)
NESP55(234-241)
NESP55(238-245)
nest basket cells
nest cells
Nestin
Nestin-GFP(+) cells
NET
NET-2
NET23
NET33
NET death
NET-forming death
NETosis
NETotic cell death
Netrin-1
netrin-1 like
netrin-1 receptor 1
Netrin-2
netrin-2 like
netrin-3
Netrin-4
netrin-5
Netrin-A
Netrin-B
netrin-G1
netrin-G1 ligand
netrin-G2
Netrin-G2 ligand
Netrins
netrinstatin-5C
netrinstatin-5D
NETs
neu
Neu3
Neublastin
Neucrin
Neudesin
neu differentiation factor
neu differentiation factor-alpha
neu differentiation factor-beta
neu/erbB2 ligand growth factor
neu/HER2 stimulatory ligand
Neulasta
Neumega
Neupogen
neu protein specific activating factor
Neural and thymus-derived activator for ErbB kinases
Neural antiproliferative protein
Neural apoptosis-regulated convertase 1
Neural cadherin
neural calcium-dependent adhesion protein
neural cell adhesion molecule
neural cell adhesion molecule-1
neural cell adhesion molecule-2
neural cell adhesion molecule-21
neural cell adhesion molecule-120
neural cell adhesion molecule-140
neural cell adhesion molecule-180
neural cell adhesion molecule like
neural cell adhesion molecule like-1
neural cells
neural cell surface antigen
Neural crest boundary cap cells
neural crest cells
neural EGF-like
neural EGF-like 1
neural EGF-like 2
Neural-endocrine-immune system
Neural epidermal growth factor-like
neural epidermal growth factor-like 1
neural epidermal growth factor-like 2
Neural Growth Factor
Neuralin-1
neural membrane protein 35
neural plate border cells
Neural Precursor Cell Expressed Developmentally Downregulated 2
neural regeneration protein
Neural stem cell-derived neuronal survival protein
neural stem cells
neural syndecan
neural tissue-specific cysteine-rich protein
neuregulin
neuregulin-1
Neuregulin-1-alpha
Neuregulin-1-beta
Neuregulin-1-beta-1
Neuregulin-1-beta-2
Neuregulin-1-beta-3
Neuregulin-1-beta-4
neuregulin-1 type I
neuregulin-1 type II
neuregulin-1 type III
neuregulin-1 type IV
neuregulin-1 type V
neuregulin-1 type VI
Neuregulin-2
Neuregulin-2-alpha
Neuregulin-2-beta
Neuregulin-3
Neuregulin-4
neuregulin-6
Neuregulins
neu-related lipocalin
Neurexin-1
Neurexin-1-alpha
Neurexin-1-beta
Neurexin-2
Neurexin-2-alpha
Neurexin-2-beta
Neurexin-3
Neurexin-3-alpha
Neurexin-3-beta
Neurexin-4
Neurexins
Neurexophilin-1
Neurexophilin-2
Neurexophilin-3
Neurexophilin-4
Neurexophilins
NeurimmiRs
Neurite extension factor
neurite outgrowth inhibitor
neurite growth inhibitor 220
neurite outgrowth inhibitor A
neurite outgrowth inhibitor B
neurite outgrowth inhibitor C
Neurite growth-promoting factor-1
Neurite growth-promoting factor-2
Neurite growth-promoting protein
Neurite inducing factor
Neurite outgrowth-promoting proteins
Neurite-promoting factor
Neurite promoting factors
Neurite retraction factor
Neuritin
Neuritin 1
neuroblastic type neuroblastoma cells
Neuroblastoma
neuroblastoma apoptosis-related RNA-binding protein
neuroblastoma apoptosis-related RNA-binding protein-1
neuroblastoma apoptosis-related RNA-binding protein-2
neuroblastoma apoptosis-related RNA-binding protein-3
neuroblastoma-derived secretory protein
Neuroblastoma-derived sulfhydryl oxidase
Neuroblastoma growth factor
Neuroblastoma growth inhibitory factor
neuroblastoma I-type cells
neuroblastoma intermediate type cells
neuroblastoma N-type cells
neuroblastoma S-type cells
neuroblastoma, Suppression of Tumorigenicity-1
Neuroblasts
Neurocrescin
neurocytes
neuro-d4
neurodegeneration-associated molecular patterns
neuroectodermal
neuroendocrine cells
neuroendocrine carcinoma of the skin
neuroendocrine differentiation factor
Neuroendocrine protein 7B2
Neuroendocrine protein 7B2 (198-210)
Neuroendocrine regulatory peptide-1
Neuroendocrine regulatory peptide-2
Neuroendocrine regulatory peptide-3
Neuroendocrine regulatory peptide-4
neuroendocrine secretory protein of 55 kDa
Neuroendocrine-specific protein-like 2
neuro-endocrine specific protein VGF
Neuroendocrine stress axis
neuroepithelial bodies
neuroepithelial stem cells
neuroepithelial tyrosine kinase
Neurogenesin-1
Neurogenic locus notch homolog protein 1
Neurogenic locus notch homolog protein 2
Neurogenic locus notch homolog protein 3
Neurogenic locus notch homolog protein 4
neuroglandular antigen
neurogliaform cells
neurogliaform interneurons
neurogliaform neurons
neuroglial cells
Neuroglian
neuro/glioblastoma-derived
neuroglioblasts
Neuroglobin
Neuroglycan C
Neurogranin
neurogranin(55-78)
neurohormones
neurohypophysial astrocytes
neurohypophysial glial cells
Neuroimmune network
neuroimmune regulatory proteins
neuro-immune-related microRNAs
neuroimmune semaphorins
Neuroimmunoendocrinology
Neuroimmunomodulation
neuroimmunoregulatory molecules
Neurokines
Neurokinin-1
neurokinin-1 receptors
Neurokinin-2
neurokinin-2 receptors
Neurokinin-3
Neurokinin A
Neurokinin-alpha
Neurokinin A receptor
Neurokinin B
Neurokinin-beta
Neurokinin B receptor
neurokinin receptor from Drosophila
neurokinins
neurolemmocytes
Neuroleukin
neuroleukin receptor
Neuroligin-1
Neuroligin-2
Neuroligin-3
Neurolin
neurolysin
neurolysin(24-16)
Neuromacin
neuromasts
Neuromedin B
Neuromedin C
Neuromedin K
Neuromedin K receptor
Neuromedin L
Neuromedin N
Neuromedin S
Neuromedins
Neuromedin S(28-52)
Neuromedin U
Neuromedin U-8
Neuromedin U-23
Neuromedin U-25
neuromedin U precursor-related peptide
neuromedin U precursor-related peptide 33
neuromedin U precursor-related peptide 36
Neuromedin-U receptor 1
Neuromedin-U receptor 2
Neuromedin-U receptor 2S
neuromembrane protein 35
neuromesodermal progenitors
neuromodulin
neuromuscular junction-capping cells
Neuronal acetylcholine receptor subunit alpha-7
neuronal activity-regulated pentraxin
Neuronal and epithelial glutamate transporter
Neuronal apoptosis inhibitor protein
Neuronal apoptosis inhibitor protein 1
Neuronal apoptosis inhibitor protein 2
Neuronal apoptosis inhibitor protein 3
Neuronal apoptosis inhibitor protein 4
Neuronal apoptosis inhibitor protein 5
Neuronal apoptosis inhibitor protein 6
neuronal apoptosis inhibitory protein related sequence 1
neuronal apoptosis inhibitory protein related sequence 2
neuronal apoptosis inhibitory protein related sequence 3
neuronal apoptosis inhibitory protein related sequence 4
neuronal apoptosis inhibitory protein related sequence 5
neuronal apoptosis inhibitory protein related sequence 6
Neuronal axonal membrane protein NAP-22
neuronal BAK
neuronal basket cells
Neuronal cell death-inducible putative kinase
neuronal cells
neuronal development-associated protein
Neuronal development-associated protein 7
Neuronal differentiation factors
neuronal/glial 2
neuronal growth inhibition factor
neuronal growth regulator 1
Neuronal IL16
neuronal IL17-related factor
neuronal/immune-related microRNAs
neuronal interleukin-17-related factor
neuronal intermediate progenitor cells
neuronally expressed EPH-related tyrosine kinase
Neuronal migration protein GC14
Neuronal nicotinic alpha-7 receptors
Neuronal olfactomedin-related ER localized protein-1
neuronal pentraxin 1
neuronal pentraxin 2
Neuronal restricted precursors
Neuron-derived neurotrophic factor
neuron-derived orphan receptor-1
neuronectin
Neuron-enriched acidic protein 22kDa
neuron-glia cell adhesion molecule
neuron navigator 1
neuron navigator 2
neuron navigator 3
neuronophages
Neuronostatin
Neuronostatin-11
Neuronostatin-13
Neuronostatin-19
Neuronotrophic factors
Neuronotrophin-3
Neuronotrophin-4
neuronotrophin-5
Neuronotrophins
neurons
neurons of Lugaro
Neuron-specific enolase
neuron-specific protein-like protein 2
Neuroparsin
Neuroparsin-1
Neuroparsin-2
Neuroparsin-3
Neuroparsin-4
Neuroparsin A
Neuroparsin B
Neuroparsins
neuropathy, axonal, motor-sensory with deafness and mental retardation
neuropeptide AF
neuropeptide B
Neuropeptide Dictionary
neuropeptide EI
neuropeptide EV
neuropeptide F
neuropeptide FF
neuropeptide FF1 receptor
neuropeptide FF2 receptor
neuropeptide FF(85-99)
neuropeptide FF receptor
neuropeptide FF receptor 1
neuropeptide FF receptor 2
neuropeptide FF receptor 2(276-288)
Neuropeptide F-like receptor
Neuropeptide F receptor
neuropeptide F receptor 76F
Neuropeptide-gamma
neuropeptide GE
neuropeptide glycine-glutamic acid
neuropeptide glutamic acid-isoleucine
Neuropeptide G-protein-coupled receptor
neuropeptide HA
Neuropeptide K
Neuropeptide-like 1
Neuropeptide-like 2
Neuropeptide-like 3
Neuropeptide-like 4
Neuropeptide-like precursor 1
Neuropeptide-like precursor 2
Neuropeptide-like precursor 3
Neuropeptide-like precursor 4
Neuropeptide-like protein 29
Neuropeptide-like protein 31
neuropeptide NA
Neuropeptide PDF
neuropeptide Q
Neuropeptide Q(53-70)
neuropeptides B/W receptor 1
neuropeptides B/W receptor 2
neuropeptides
Neuropeptide S
neuropeptide SA
Neuropeptide SF
neuropeptide S receptor
neuropeptide S receptor 1
neuropeptide S receptor 1A
neuropeptide S receptor 1B
neuropeptide SS
Neuropeptide Tyrosine
Neuropeptide VF
neuropeptide W
neuropeptide W-23
neuropeptide W-30
neuropeptide W receptor 1
neuropeptide W receptor 2
Neuropeptide Y
Neuropeptide Y-HS
neuropeptide Y neurons
neuropeptide Y receptor-like
neuropeptide Y receptor Y3
neuropeptide YY
Neuropsin
neurosin
Neurophysin neurons
neurophysin-vasopressin-associated glycoprotein
Neuropilin
Neuropilin-1
Neuropilin-2
Neuropoietin
Neuropoietins
Neuropoietic cytokines
neuropolypeptide h3
neurosecretory cells
neurosecretory neurons
neurosecretory protein GL
neurosecretory protein GM
neurosecretory protein VGF
Neurosecretory protein VGF(24-60)
neurosecretory protein VGF(24-63)
neurosecretory protein VGF(180-209)
Neurosecretory protein VGF(211-235)
neurosecretory protein VGF(281-306)
Neurosecretory protein VGF(285-309)
neurosecretory protein VGF(310-347)
Neurosecretory protein VGF(352-372)
Neurosecretory protein VGF(487-507)
neurosecretory protein VGF(489-507)
Neurosecretory protein VGF(491-507)
Neurosecretory protein VGF(587-600)
Neurosecretory protein VGF(601-617)
neurospheres
Neurotactin
Neurotensin
neurotensin(1-8)
neurotensin(1-10)
neurotensin(1-11)
neurotensin-(1-13)
Neurotensin-(8-13)
neurotensin cells
Neurotensin endopeptidase
Neurotensin neurons
Neurotensin receptor 1
Neurotensin receptor 2
Neurotensin receptor 3
neurotensin-related peptide
Neurothelin
neurotractin
Neurotrimin
Neurotrophic factor-3
Neurotrophic factor-4
Neurotrophic factor-5
Neurotrophic factor-6
Neurotrophic Factor-Α1
Neurotrophic Factor-alpha-1
Neurotrophic factors
neurotrophic tyrosine kinase receptor 1
neurotrophic tyrosine kinase receptor 2
neurotrophic tyrosine kinase receptor 3
neurotrophic tyrosine kinase receptor 4
neurotrophic tyrosine kinase receptor-related 1
neurotrophic tyrosine kinase receptor-related 2
neurotrophic tyrosine kinase receptor-related 3
Neurotrophin-1
Neurotrophin-2
Neurotrophin-3
Neurotrophin-4
Neurotrophin-5
Neurotrophin-6
Neurotrophin-6-alpha
Neurotrophin-6-beta
Neurotrophin-6-gamma
Neurotrophin-7
Neurotrophin-4/5
neurotrophin receptor alike death domain protein
neurotrophin receptor homolog-1
neurotrophin receptor homolog-2
neurotrophin receptor interacting factor
neurotrophin receptor interacting factor-1
neurotrophin receptor interacting factor-2
Neurotrophin receptor-interacting MAGE homolog
Neurotrophins
Neurturin
Neurturin receptor-alpha
Neustim
neutral cells
neutral endopeptidase
neutral endopeptidase 24.11
neutral sphingomyelinase activation-associated factor
neutrocytes
Neutrogin
Neutrophil-activating factor
Neutrophil-activating protein-1
Neutrophil-activating protein-2
Neutrophil-activating protein-3
Neutrophil-activating protein-4
Neutrophil-activating protein S
neutrophil adherence receptor alpha-M
Neutrophil alkaline phosphatase inducing factor
neutrophil alloantigen 1
neutrophil alloantigen 2
Neutrophil antibiotic peptide NP1
Neutrophil antibiotic peptide NP2
Neutrophil antibiotic peptide NP-3A
Neutrophil antibiotic peptide NP-3B
Neutrophil antibiotic peptide NP6
neutrophil antigen 1
Neutrophil antigen NA
neutrophil azurocidin
Neutrophil cationic peptide 1
Neutrophil cationic peptide 1 type A
Neutrophil chemotactic activity
Neutrophil chemotactic factor
Neutrophil chemotactic protein
neutrophil collagenase
Neutrophil colony stimulating activity
neutrophil-DC hybrids
neutrophil-dendritic cell hybrids
Neutrophil-derived colony inhibitory factor
neutrophil-derived dendritic cells
Neutrophil-derived Giant Phagocytes
Neutrophil-derived Heparin binding protein
Neutrophil-derived histamine releasing activity
Neutrophil-derived lymphocyte chemotactic factor
Neutrophil-derived monocyte chemotactic factor
Neutrophil extracellular trap-forming death
Neutrophil extracellular traps
neutrophil gelatinase-associated lipocalin
Neutrophil-granulocyte colony stimulating factor
neutrophilic granulocytes
neutrophilic leukocytes
Neutrophilic myelocytes
neutrophilic segmented granulocytes
neutrophilic stab granulocytes
neutrophilin
Neutrophil migration inhibition factor from T-lymphocytes
neutrophil-immobilizing factor-1
neutrophil-immobilizing factor-2
Neutrophil inhibitory factor
Neutrophil migration inhibitory factor
neutrophilopoietin
neutrophil peptide-1
neutrophil peptide-2
Neutrophil recruitment inhibitory factor
neutrophil-regulatory T-cells
Neutrophil releasing activity
neutrophils
neutrophil-specific antigen 1
NEV
NEVDEE
NEVDQE
Newcastle disease virus V protein
New CC chemokine-1
New CC chemokine-2
New CC chemokine-3
New CC chemokine-4
New EST tetraspan 2
Newfoundland blood group
newly identified cDNA from the EDC
New molecule containing SH3 at the carboxy-terminus
New Zealand black mice serum factor
Nexin-1
Nexin-1(106-119)
Nexin-II
nex-1

NF
NF-A3
NF-alpha-1
NF-AT
NFBP
NFDEIDRAGMGFA
NFDEIDRSGFGFA
NFDEIDRSGFGFN
NFDEIDRSGFGFV
NFDEIDRSSFGFN
NFGYDLYRVRSSMSPTTN
NFHEV
N-formyl peptide receptor
NF-IL6
NF-kappa-B
NF-kappa-B1
NF-kappa-B2
NF-kappa-B binding protein
NF-kappa-B essential modifier
NF-kappa-B essential modulator
NF-kappa-B-inducible DED-containing protein
NF-kappa-B-inducing kinase
NF-kappa-B inhibitor alpha
NF-kappa-B inhibitor beta
NF-kappa-B inhibitor kinase beta
NF-kappa-B interacting protein 1
NF-kappa-B subunit 1
NF-kappa-B subunit 2
NF-kappa-B subunit 3
NFKB1
NFKB2
NFKBIA
NFKBIB
NFKBID
NFKBIE
NFKBIZ
NFKFNPWGamide
NFLD antigen
NFLGTLINLAKKIM
N-formylated Humanin
NFS-60

Ng
Ng1
NG2
NG2 cells
NG2-expressing glial cells
NG2(+) glial cells
NG29
NGA
NGAL
NGB
NGC
NGC-1
NGC-2
NGC-3
NgCAM
NGE
NGF
NGF-2
Ngfa
NGF-alpha
NGFB
NGF-beta
NGF cells
NGF family
NGFG
NGF-gamma
NGFI
NGFI-A
NGFI-B
NGFI-C
NGF-induced protein 42A
NGF-induced protein 42C
NGF-inducible large external
NGF-like protease
NGFR
NGFRAP1
NGFRAP1L1
NGFR associated protein 1
NGF receptor associated protein 1
NGF receptor-associated protein 1-like 1
NGF receptors
NGGTADALYNLPDLEKIamide
NGGTSGLFAFPRVamide
NGIF
NGKKACLNPASPMVQKIIEKIL
NGKKHQKKKVLKVRKSQRSRQKKTT
NGKEICLDPEAPFLKKVIQKILD
NGKQVCLDPEAPFLKKVIQKILDS
Ngl
NGL
NGL-1
NGL-2
N-glucagon
NGN
NGNLLGGLLRPVLGVVKGLTGGLGKK
NGR
NgR
NgR1
NgR2
NGR3
NGRAHA
NGRH1
NGRH2
NGRKACLNPASPIVKKIIEKMLNS
NGRKICLDLQALLYKKIIKEHLES
NGRKICLDLQAPLYKKIIKKLLES
NGRL3
NGR peptides
NGVQPKY
NGVQPKYKWWKWWKKWW
NGVQPKYRWWRWWRRWW

NH cells
NHEMs
NhhA
NHQQQNPHQPPM

NI-220
NI-35/250
Niacin receptor 1
Niacin receptor 2
NIACR1
NIACR2
NIAID
NIATMARLQSAPSTHRDP
Niban-like protein 2
NIBSC
NICE-2
nicein
niche
niche cells
nicked chorionic gonadotropin
nicked hCG
NickFect51
Nicotinamide phosphoribosyltransferase
Nicotinic acid receptor 1
Nicotinic acid receptor 2
nicotinic cholinergic receptor alpha-7
Nicotinic receptor alpha-7
NID
NID1
Nidogen
Nidogen-1
nidoviral uridylate-specific endoribonuclease
Niemann-Pick cells
Nidd5
NIF
NIF-1
NIF-2
NIF-T
Nigrocin-1
Nigrocin-2
Nigrocin-2GRa
Nigrocin-2GRb
Nigrocin-2GRc
nigrocin-2ISa
nigrocin-2ISb
Nigrocins
NIH 3T3
NijA
NIK
Nil-2-a
NIL-3
NIL16
NILE
NILR
NILSSIVNGINRALSFFG
NIM
NIM-1
NIMA-interacting protein 2
NimB5
NimC1
NimC4
Nimrod B5
Nimrod C1
Nimrod C4
Nimrod family
Nin
NIN1
Ninein
ninein like mouse
ninein-lm
NINJ1
NINJ2
Ninjurin
Ninjurin-1
Ninjurin-2
Ninjurin A
NIP-1
NIP-2
NIP-3
Nip3-like protein X
NIP71
Nipah virus C protein
Nipah virus P protein
Nipah virus V protein
Nipah virus W protein
NIPC
nIPCs
NIPK
NIR1
NIREGs
NIRF
NIRG cells
NISCH
Nischarin
nitrergic neurons
nitric oxide amacrine cells
Nitric oxide-inducible gene protein
nitric oxide neurons
Nivolumab
NIX

NJAC

NK
NK1
NK-1
NK1 cells
NK1R
NK1 receptors
NK2
NK-2
NK2A
NK2B
NK2C
NK2 cells
NK2R
NK2 receptors
NK3
NK3R
NK3 receptors
NK4
NK1.1
NK-18
NK-22 cells
NK28
NKA
NKAF
NK-associated transcript-1
NK-associated transcript-2
NK-associated transcript-3
NK-associated transcript-4
NK-associated transcript-5
NK-associated transcript-6
NK-associated transcript-7
NK-associated transcript-8
NK-associated transcript-9
NK-associated transcript-10
NKAT1
NKAT2
NKAT3
NKAT4
NKAT5
NKAT6
NKAT7
NKAT8
NKAT9
NKAT10
NKB
NKB1
NKB-cells
NKC3
NK-cell activation-inducing ligand
NK-cell proliferation inducing factor
NK-cell receptor 2B4
NK-cell receptor A
NK-cell receptor D
NK-cell receptor P1
NK-cell receptor P1A
NK-cell receptor P1B
NK-cell receptor P1C
NK-cell receptor P1D
NK-cell receptor P2
NK-cell receptor protein-2
NK-cells
NK-cell T-cell B-cell antigen
NKCF
NK-CIA
NKCS
NK-CTL
NK-cytolytic T lymphocytes
NK-cytotoxic T lymphocytes
NKD
NKDCs
NK dendritic cells
NKEF
NKEF-A
NKEF-B
NKG2
NKG2A
NKG2B
NKG2C
NKG2D
NKG2E
NKG2F
NKG5
NKG7
NKH
NKH-1
NKI-C3
NK inhibitory factor
NK inhibitory receptor
Nkip1
NKIR
NK-ireg cells
NKL
NK-LAK cells
NKLAM
NK-LCF
NK-like B-cells
NK-like T-cells
NKLP27
NK-LRIF
NK-lymphocytes
NK-lysin
NK-lysin(39-56)
NK-lysin(39-65)
NK lytic-associated molecule
NKNA
NKNB
NKNPFLFGSNR
NKp30
NKp30A
NKp30B
NKp30C
NKp44
NKp46
NKp65
NKp80
NKR2B4
NK-released peptide
NK-RIF
NKR-LTi cells
NKR lymphoid tissue inducer cells
NKR-P1
NKR-P1A
NKR-P1B
NKR-P1C
NKR-P1D
NKR-P2
NKR-P1.9
NKSF
NKSF1
NKSF2
Nkt
NKT1-cells
NKT1(a) cells
NKT1(b) cells
NKT2-cells
NKT10 cells
NKT17-cells
NK-T-B antigen
NKT-cells
NK type T-cells

NL63 PLP2
NLARVPKLDL
NleB
NleC
NleD
NleE
NleF
NleH
nleH1
nleH2
Nl-elevenin
NLENTVKETIKYLKSLFSHAFEVVKT
NLERK1
NLERK2
NLF20
NLFRKLTHRLFRRNFGYTLR
NLGALKSSPVHGVQQ
NLGN1
NLGN2
NLGN3
NLIKQDDGGSPIRHY
NLK
NLKAIAALAKKLL
NLLMAAS
N-L-Methionyl-[1-165]-SCF
NLN
NLNNLGSFQVHGW
NLP
nlp-29
nlp-31
NLRB
NLRB1
Nlrb1a
Nlrb1b
Nlrb1c
Nlrb1d
Nlrb1e
Nlrb1f
NLRC1
NLRC2
NLRC3
NLRC4
NLRC4 inflammasome
NLRC5
NLRC5 inflammasome
NLR family
NLR family, CARD domain containing 1
NLR family, CARD domain containing 2
NLR family, CARD domain containing 3
NLR family, CARD domain containing 4
NLR family, CARD domain containing 5
NLR family member X1
NLR family, pyrin-domain containing 1
NLR family, pyrin-domain containing 2
NLR family, pyrin-domain containing 3
NLR family, pyrin-domain containing 3 pseudogene
NLR family, pyrin-domain containing 3 pseudogene 1
NLR family, pyrin-domain containing 4
NLR family, pyrin-domain containing 5
NLR family, pyrin-domain containing 6
NLR family, pyrin-domain containing 7
NLR family, pyrin-domain containing 8
NLR family, pyrin-domain containing 9
NLR family, pyrin-domain containing 10
NLR family, pyrin-domain containing 11
NLR family, pyrin-domain containing 12
NLR family, pyrin-domain containing 13
NLR family, pyrin-domain containing 14
NLR family, pyrin-domain containing 15
NLR family, pyrin-domain containing 16
NLRP1
NLRP1 inflammasome
NLRP2
NLRP3
NLRP3 inflammasome
NLRP3P
NLRP3P1
NLRP4
NLRP5
NLRP6
NLRP6 inflammasome
NLRP7
NLRP8
NLRP9
NLRP9a
NLRP9b
NLRP9c
NLRP9b inflammasome
NLRP10
NLRP11
NLRP12
NLRP13
NLRP14
NLRP15
NLRP16
NLRX1
NLS
NLVSALIEGRKYLKNVLKKLNRLKEKNKAKNSKENN
NLVSGLIEARKYLEQLHRKLKNCKV

nm23
nm23A
nm23B
nm23B(2-16)
nm23-H1
nm23-H2
nm23-H6
nm23-H7
NMA
NMAINPSK
NMAINPSKENLCSTFCK
NMB
nmb
NMC
NMDARA1
NMDA receptor-associated protein 1
NMDA receptor regulated 1
NMDGF
NME1
NME2
NME6
NME7
NME7AB
NME2(2-16)
NMJ-capping cells
NMN
NMN diphosphorylase
NMN pyrophosphorylase
NMOR1
NMP35
NMPs
Nmrk
nmRNAs
NMS
NmU
NMU1
NMU1R
NMU2
NMU2R
NMU2RS
NmU-8
NmU-23
NmU-25
NMUR1
NMUR2
NMUR2S

NN
NNANVFYPWGamide
NNEAQCEQAGGICSKDHCFHLHTRAFGHCQRGVPCCRTVYD
NNKLCAKLGNGLKFNNGDICIKDSIN
NNP47
NNPNVFYPWGamide
NNT-1
NNT-1/BSF-3

N-myc
N-Myc downstream regulated-4

NNATFYFKIDNVKKAR
NNO4

NO3
no-action potential
NO amacrine cells
NOB-1
Noc
NOCD
Nociceptin
Nociceptin/Orphanin FQ
nociceptin receptor
nociceptive Schwann cells
nociceptor cells
nociceptor neurons
nociceptors
NOCIR
Nocistatin
n-octanoylated ghrelin
NOD1
NOD2
NOD2B
NOD3
NOD5
NOD6
NOD8
NOD9
NOD12
NOD14
NOD16
NOD17
NOD27
nodal
Nod-like receptors
NOD mouse
nodosome
NOD/SCID
NOD/SCID/Beta-2-Microglobulin mice
NOE1
NOE2
NOE3
NOEL1
Noelin
Noelin-1
Noelin-2
Noelin-3
Noelin-4
Noelins
N/OFQ
NOG
Noggin
NOG mice
Nogo
Nogo-66
Nogo-66 receptor
Nogo-66 receptor homolog 1
Nogo-66 receptor homolog 2
Nogo-66 receptor-related protein 2
Nogo-66 receptor-related protein 3
Nogo-66(1-40)
Nogo-66(1-40) antagonist peptide
Nogo-A
Nogo-A-Δ20
Nogo-B
Nogo-C
NOGOR
Nogo receptor
Nogo receptor 1
Nogo receptor 2
Nogo receptor-like 2
Nogo receptor-like 3
Noktochor
NOL3
nomenclature
NOMID
Nona-arginine
Non-adherent three-dimensional cell culture
non-adrenergic non-cholinergic neurons
non-A non-B -intercalated cells
non-arginase growth inhibitory factor
Nonarginine
nonastrocytic inner retinal glia-like cells
non-autonomous apoptosis
non-autonomous cell death
non-B-cells
non-beta-cells
non-B/non-T-cells
noncanonical function proteins
non-canonical inflammasome
noncanonical miRNAs
non-canonical NF-kappa-B pathway
non-canonical Notch ligands
non-canonical Wnt proteins
non-canonical Wnt signaling
non-cell-autonomous death
non-cell-autonomous necrosis
nonciliated bronchiolar epithelial cells
nonciliated bronchiolar secretory cells
non-classical chemokine receptors
nonclassical monocytes
non-classical neuropeptides
Non-classical NKT-cells
non-classical opioid receptor
non-classic Th1 cells
non-coding RNAs
non-conventional large interneurons
non-conventional T-cells
non-cycling cells
non-differentiated cells
Non-disulfide bridged protein family 5
Non-disulfide-bridged peptide 2.8
Non-disulfide-bridged peptide 3.4
Non-disulfide-bridged peptide 4.1
Non-ELR Chemokines
NO neurons
Nonhematopoietic endothelial progenitor cells
Nonhematopoietic EPCs
non-hematopoietic stem cells
Non-hepatic arginase
non-histone chromosomal protein H6
non-HSCs
non-immunogenic apoptosis
non-immunogenic cell death
non-insulin-dependent diabetes 5
Non-Interleukin-2
noninvariant NKT-cells
nonketotic hyperglycinemia
non-LEE-encoded effector B
non-LEE-encoded effector C
non-LEE-encoded effector D
non-LEE-encoded effector E
non-LEE-encoded effector F
non-LEE-encoded effector H
non-LEE-encoded effector H1
non-LEE-encoded effector H2
Non-lymphoid leukemia
nonmessenger RNAs
nonmetastatic cells 1
nonmetastatic cells 2
nonmetastatic cells 6
nonmetastatic cells 7
nonmetastatic cells 2(2-16)
nonmetastatic gene 23
nonmetastatic gene 23A
nonmetastatic gene 23B
nonmetastatic gene 23B(2-16)
nonmetastatic gene 23 homolog 6
nonmetastatic gene 23 homolog 7
Non-metastatic gene A protein
Non-MHC restricted killing associated
Non-myocyte-derived growth factor
non-myelinating Schwann cells
non-myelin-forming cells
non-neuronal cells
non-obese diabetic mice
non-obese diabetic severe combined immunodeficiency
non-oncogene addiction
non-parenchymal cells
non-plate neurons
non-professional antigen-presenting cells
non-professional phagocytes
non-professional phagocytic cells
non-protein coding RNA 43
non-protein-coding RNAs
nonreceptor-type protein-tyrosine phosphatase 10
non-regulatory FOXP3(+) T-cells
non-signaling chemokine receptors
nonspecific crossreacting antigen
nonspecific crossreacting antigen 160
nonspecific crossreacting antigen 95
nonspecific crossreacting antigen 50/90
Nonspecific cross-reacting antigen 55 kDa
Nonspecific cross-reacting antigen 90 kDa
Nonspecific cross-reacting antigen 95 kDa
Nonspecific cross-reacting antigen 100
Nonspecific cross-reacting antigen 160 kDa
Nonspecific cross-reacting antigen 50/90
Nonspecific cross-reacting antigens
nonspecific cytotoxic cell antimicrobial protein-1
nonspecific cytotoxic cells
Nonspecific suppressor factor
non-sprouting angiogenesis
Nonsteroidal-anti-inflammatory drug activated gene-1
Non-suppressible insulin-like activity
Non-suppressible insulin-like protein
non-suppressive CD4(+) regulatory T-cells
non-suppressive CD4(+) Tregs
Non-syndromic hearing impairment protein 5
non-T/non-B-cells
non-T non-B innate helper cells
Non-traditional large neurons
non-Tregs
nonvisual photoreceptor cells
non-zeta-Neoblasts
NOP
NOP30
NOR1
noradrenaline neurons
noradrenergic neurons
nord
norepinephrine neurons
Normal cross-reacting antigen
normal density granulocytes
normal density neutrophils
normal human epidermal melanocytes
Normal tension glaucoma
normoblasts
normochromic erythrocytes
normocytes
Norrie disease protein
Norrie disease protein homolog
Norrin
NOT
Notch
Notch-1
Notch-2
Notch-3
Notch-4
not really started
NOTUM
NOTUM 1a
NOTUM 2
NOV
nov
nov(211-228)
Novel erythropoiesis stimulating protein
novel interleukin receptor
novel Ly9
Novel neurotrophin-1
Novel neurotrophin-1/B-cell stimulating factor-3
Novel nucleolar protein 47
novH
Novispirin G-10
Novispirin T-7
Novispirins
Novokinin
Noxa
Noxin

NP
NP1
NP-1
NP2
NP-2
NP-3A
NP-3B
NP6
NPAF
NPB
NPBWR1
NPBWR2
NPF
NPFF
NPFF1
NPFF2
NPFFR
NPFFR1
NPFFR2
NPFFR2(276-288)
NPFHAYFSAWGamide
NPFHSWGamide
NPF motif
N-PFP
NPFR1
NPFR76F
NPG1
NPG3
NP-gamma
NPGL
NPGM
NPGPR
NPH1
NPH2
NPH3
NPH4
NPK
NPKKYIPGTKMIFVGI
NPKKYIPGTKMIFVGIKKK
Nplp1
NPLP1-VQQ
Nplp2
Nplp3
Nplp4
NPLP1-1
NPLP1-2
NPLP1-3
NPLP1-4
NPLP1-5
NPLP1-6
NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR
NPM-ALK
NPN
NPN-1
NPN-2
NPNA
NPNA(85-99)
NP neurons
NPNT
NPP
NPP-1
NPP-2
NPP2-alpha
NPP2-beta
NPP2-gamma
NPP-3
NPP-5
NPPA
NPP-alpha
NPPB
NPPC
NPP-gamma
NPPS
NPQ
NPQ(36-49)
NPQ(53-70)
NPR1
NPR2
NPR3
NPRA
NPRB
NPR-C
Npro
NPS
NPSA
NPSF
NPSR
NPSR1
NPSR1A
NPSR1B
NPSS
NPTX1
NPTX2
NPVF
NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
NPW
NPW23
NPW30
NPWR1
NPWR2
NPY
NPY3R
NPY neurons
NPYRL

NQDK
NQELLLNPTHQIYPV
NQKTMSFamide
NQO1

Nr1
NR4
NR4A1
NR4A2
NR4A3
NR6
NR-13
NR58-3.14.3
NRA
NRADD
NRAGE
nRBCs
NRC-01
NRC-02
NRC-03
NRC-04
NRC-05
NRC-06
NRC-07
NRC-08
NRC-09
NRC-10
NRC-11
NRC-12
NRC-13
NRC-14
NRC-15
NRC-16
NRC-17
NRC-18
NRC-19
NRC-20
nrd
NRD1
NRD2
NRDc
NRD convertase
NREM-OFF cells
NREM-OFF neurons
NREM-ON cells
NREM-ON neurons
NRF
NRG
NRG1
NRG1-alpha
NRG1-beta
NRG1-beta-1
NRG1-beta-2
NRG1-beta-3
NRG1-beta-4
NRG1 II-beta-3
NRG1 III-beta-3
NRG1 type I
NRG1 type II
NRG1 type III
NRG1 type III-beta-3
NRG1 type IV
NRG1 type V
NRG1 type VI
NRG2
NRG2-alpha
NRG2-beta
NRG3
NRG4
NRG4A1
NRG4A2
NRG4B1
NRG4B2
NRG4B3
Nrg180
NRG family
NRGFSRKSQTFLPKIFF
NRG II-beta-3
NRGN
NRGN(55-78)
NRH
Nrh
NRH-1
NRH-2
NRIF
NRIF1
NRIF2
NRIF3
NRK-49F
NRL
nrln1
NRLN1
NRN
NRN1
NRP
NRP1
NRP2
NRPN
NRRFVNVVPTFGK
nrs
NRTN
NRTNR-alpha
NRXN1
NRXN1-alpha
NRXN1-beta
NRXN2
NRXN2-alpha
NRXN2-beta
NRXN3
NRXN3-alpha
NRXN3-beta
NRXN4
Nrz

NS
NS1
NS2 protein
NS3 protein
NS4A protein
NS4B protein
NS5A
NS5B protein
NSAID activated gene-1
N-sam
NS cells
NSE
NSEIINSLLGLPKLLNDAamide
NSELINSILGLPKVMNDAamide
NSELINSLLSLPKNMNDAamide
NSF
NSGMINSILGIPRVMTEAamide
NSILA
NSILP
nsINH
NSKYVSKQKFYSWGamide
NSMAF
N-SMase activation-associated factor
NSm protein
NSPL2
NSP-like protein 2
NSs protein
NS suppressor factor
NST
NSVVLGKKQRFHSWGamide
N-Syndecan

NT
NT3
NT-3
NT-4
NT-5
NT5E
NT-6
NT-6-alpha
NT-6-beta
NT-6-gamma
NT-7
NT-4/5
NT(1-13)
NT(8-13)
NTAK
NTAK-alpha
NTAK-alpha-2
NTAK-beta
NTAK-delta
NTAK-gamma
NTB-A
NtBI-1
NTE
NTEC
NTEC-1
NTEC-2
N teloblasts
NT endopeptidase
N-terminal glucagon
N-terminal peptide of POMC
N-terminal peptide of proopiomelanocortin
N-terminal proBNP
NTF
NTF3
NTF4
NTF5
NTF6A
NTF6B
NTF6G
NTG
NTGDKFYGLMamide
NTL
NTM
NT/N
NTN
NTN1
NTN1L
NTN1R1
NTN2L
NTN2
NTN3
NTN4
NTN5
NTNB-cells
NT neurons
NTNG1
NTNG2
NT/NN
NTNRA
NTNR-alpha
NTPDase-1
NTPDase-2
NTPDase-3
NTPDase-5
NTPDase-6
NTPPPH
NT-proBNP
NTQATNRNTDGSTDYGIL
NTR
NTR1
NTR2
Ntra
nTregs
NTRH
NTRI
NTRK1
NTRK2
NTRK3
NTRK4
NTRKR1
NTRKR2
NTRKR3
NTRR
NTS
NTS neurons
NTSR1
NTSR2
NTSR3
NTT
NTVKETIKYLKSLFSHAFEVVKT
NTVVLGLLQAFHSWGamide
N-type neuroblastoma cells

NUAK1
NUAK family SNF1-like kinase 1
NuBCP-9
NuBCP-20
NUC
NUC-1
NUCB1
NUCB2
NUCB2/Nesf-1 neurons
NUCB2(25-106)
nuclear activating miRNAs
nuclear alarmin
nuclear apoptosis inducing factor-1
nuclear bag1 fibers
nuclear bag1 intrafusal muscle fibers
nuclear bag2 fibers
nuclear bag2 intrafusal muscle fibers
nuclear bag fibers
nuclear chain fibers
nuclear Clusterin
Nuclear DEAF-1-related protein
Nuclear DEAF-1-related transcriptional regulator
nuclear distribution gene C homolog
Nuclear DNA helicase 2
nuclear domain 10
nuclear dot 10 bodies
nuclear dots
Nuclear factor for activated T-cells
Nuclear factor for IL6
nuclear factor from high endothelial venules
Nuclear factor kappa-B
Nuclear factor NF-kappa-B inhibitor kinase alpha
Nuclear factor NF-kappa-B inhibitor kinase beta
Nuclear factor NF-kappa-B inhibitor kinase gamma
Nuclear factors
Nuclear localization sequence
Nuclear polyhedrosis viruses
Nuclear protein-475
nuclear pyknosis
nuclear receptor-77
nuclear receptor 4A1
nuclear receptor 4A2
nuclear receptor 4A3
nuclear receptor interacting factor-3
nuclear receptor of T-cells
nuclear receptor-related factor 1
nuclear receptor subfamily 4 group A member 1
nuclear receptor subfamily 4 group A member 2
nuclear receptor subfamily 4 group A member 3
nuclear reprogramming
nuclear targeting sequence
nuclear transport sequence
nucleated cells
nucleated red cells
Nucleic acid dioxygenase ALKBH1
nucleic acid editing
Nucleobindin
nucleobindin-1
Nucleobindin-2
Nucleobindin-2(25-106)
nucleolar 7-2 RNA protein particle
Nucleolar GTP-binding protein 3
nucleolar protein-3
nucleolar protein of 30 kDa
Nucleolar RNA helicase 2
Nucleolar RNA helicase Gu
nucleolin
nucleophagy
Nucleophosmin-anaplastic lymphoma kinase
Nucleoredoxin-like protein 1
nucleoredoxin-like 2
Nucleoside diphosphate kinase
Nucleoside diphosphate kinase A
Nucleoside diphosphate kinase B
Nucleoside diphosphate kinase 6
Nucleoside diphosphate kinase 7
Nucleoside diphosphate kinase B(2-16)
nucleoside triphosphate diphosphohydrolase 1
nucleoside triphosphate diphosphohydrolase 2
nucleoside triphosphate diphosphohydrolase 3
nucleoside triphosphate diphosphohydrolase 5
nucleoside triphosphate diphosphohydrolase 6
nucleoside triphosphate pyrophosphohydrolase
Nucleostemin
nucleotide-binding domain and CARD containing protein
Nucleotide-binding oligomerization domain protein 1
Nucleotide-binding oligomerization domain protein 2
Nucleotide-binding oligomerization domain protein 3
Nucleotide-binding oligomerization domain protein 5
Nucleotide-binding oligomerization domain protein 6
Nucleotide-binding oligomerization domain protein 8
Nucleotide-binding oligomerization domain protein 9
Nucleotide-binding oligomerization domain protein 12
Nucleotide-binding oligomerization domain protein 14
Nucleotide-binding oligomerization domain protein 16
Nucleotide-binding oligomerization domain protein 17
Nucleotide-binding oligomerization domain protein 27
Nucleotide-binding site protein 1
nucleotide pyrophosphatase
nucleotide pyrophosphatase/phosphodiesterase-1
nucleotide pyrophosphatase/phosphodiesterase-2
nucleotide pyrophosphatase/phosphodiesterase 3
nucleotide pyrophosphatase/phosphodiesterase-5
nucleotide pyrophosphatase/phosphodiesterase-alpha
nucleotide pyrophosphatase/phosphodiesterase-gamma
nucleus pulposus cells
Nucling
nudC
NUDC
Nude
NUDR
Nuk
null cells
null mice
null mutations
nu-Neoblasts
Nuocytes
nup475
nur-77
Nur-77-derived BCL2-converting peptide with 9 amino acids
Nur-77-derived BCL2-converting peptide with 20 amino acids
Nur-77(480-499)
Nur-77(489-497)
NURP
NURP33
NURP36
Nurr-1
nurse cells
nurse macrophages
nursing cells
nurse-like cells

NVAAVARYNSQHGHIQRAGAE
NVGTLARDFQLPIPNamide
NVLQPSS
NVLSSVANGINRALSFFG
NVQYMSPCHFKICNMGamide
NVVRQ

N-WASP-binding protein
NWTPQAMLYLKGAQamide
NWTPQAMLYLKGTQamide

Nx
NX1838
NX1975
NXNL1
NXNL2
NXPH1
NXPH2
NXPH3
NXPH4

NY-CO-7
NY-CO-27 antigen
Nyk
NY-REN-4
NY-REN-9
NY-REN-11
NY-REN-27
NY-REN-42
NY-REN-44
NY-REN-46
NY-REN-47
NY-REN-51
NY-REN-59
NY-REN-64
NYYGWMDFamide

NZ2 14.7 kDa protein
NZ7 16 kDa protein
NZ7 VEGF
NZB-SF



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.