necrotoxigenic Escherichia coli type 2 |
Nectin |
DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL |
||
Nectadrin is a cell surface glycoprotein recognized by mAb 79. It is a glycoprotein with a polypeptide core of only 30 amino acids and a very high carbohydrate content (Wenger et al, 1991). Kadmon et al (1992) have reported that nectadrin is immunologically identical to HSA [heat stable antigen].
In the nomenclature of CD antigens this protein has been given the designation CD24 (CD24a).
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |