Neurotrophins |
Neurturin receptor-alpha |
SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSVK |
||
abbr. NTN, approved gene symbol NRTN. This factor (203 amino acids) has been identified in the conditioned medium of Chinese hamster ovary cells. It was purified on the basis of its ability to support the survival of cultured sympathetic neurons and sensory neurons of the nodose and dorsal root ganglia.
Neurturin is structurally related to GDNF [Glial cell line-derived neurotrophic factor] (Kotzbauer et al, 1996) and, together with GDNF forms a distinct subfamily of factors related to TGF-beta referred to as the TRN family [TGF-beta-related neurotrophins]. Mouse
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |