nociceptin receptor |
nociceptor cells |
SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVY |
||
[nociceptive Schwann cell]
This cell type has been described by Abdo H et al (2019). Nociceptive Schwann cells represent a specialized cutaneous glial cell type with extensive processes forming a mesh-like network in the subepidermal border of the skin that conveys noxious thermal and mechanical sensitivity. These cells are part of a previously unknown organ that has an essential physiological role in sensing noxious stimuli through a direct excitatory functional connection to sensory neurons.
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |