NB-GF |
nbl |
ATCDLLSPFKVGHAACAAHCIARGKRGGWCDKRAVCNCRK |
||
[Natural Born Killer] NBK is known also as BIK, BP4 and Bip-1.
NBK was identified as a protein capable of interacting with Adenovirus E1B 19 kDa protein (Han et al, 1996). NBK also interacts with BCL2 but not with BAX. NBK contains the BCL2 homology domain BH3, but not the domains BH1 or BH2. NBK is a protein promoting cell death by apoptosis and its expression functionally antagonizes inhibition of apoptotic cell death mediated by the viral protein.
In CD3(+) CD4(+) CD8(-)
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |