NPWR2 |
NPY3R |
NME7 |
||
[neuropeptide Y, Y Neuropeptide; neuropeptide Tyrosine] This peptide (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY) is the most ubiquitously expressed peptide in the mammalian nervous system and highly conserved in its sequence (Baker et al, 1995). The amphibian counterpart of NPY has been termed Melanostatin [melanotropin-release-inhibiting factor].
Yang et al (2008) have reported that NPY is produced also in visceral adipose tissue and promotes proliferation of adipocyte precursor cells.
The gene encoding NPY has been cloned by Minth et al (1984) and Takeuchi et al (1986) from mRNA obtained from a
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |