Neutrophil chemotactic activity |
Neutrophil chemotactic protein |
GPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW |
||
abbr. NCF (a term with multiple meanings). Also: neutrophil chemotactic protein. This protein is produced by monocytes, endothelial cells, and fibroblasts. It is identical with IL8 and therefore belongs to the family of chemotactic cytokines known as Chemokines (see also: Chemotaxis). Its synthesis can be induced by TNF-alpha, bacterial endotoxins, and IL1-beta (see: IL1).
In addition, there are other, as yet unidentified factors having the same activity. Some of these factors have molecular weights below 1 kDa (see: fMLP
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |