Neuropeptide VF |
neuropeptide W-23 |
Engrailed-2b |
||
abbr. NPW. This neuropeptide (WYKHVASPRYHTVGRAAGLLMGL), isolated originally from porcine hypothalamus, is derived from a prepro-protein of 165 amino acids (termed PPNPW [prepro-neuropeptide W]) and exists in two forms, designated neuropeptide W-23 (23 amino acids; abbr. NPW23) and neuropeptide W-30 (30 amino acids; abbr. NPW30; WYKHVASPRYHTVGRAAGLLMGLRRSPYLW) (Shimomura et al, 2002). The amino acid sequence of NPW23 is completely identical to that of the N-terminal 23 residues of NPW30. The human
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |