Netrin-G2 ligand |
netrinstatin-5C |
KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF |
||
Netrin-1 (abbr. NTN1) and Netrin-2 (abbr. NTN2) were isolated as factors secreted from floor plate cells at the ventral midline of the embryonic spinal cord of chicken brain. The two Netrins are homologous to UNC6, a laminin-related protein required for the circumferential migration of cells and axons in Caenorhabditis elegans. Human netrin-1 and netrin-2 have been called NTN1L (netrin-1 like) and NTN2L (netrin-2 like), respectively. NTN1L (human
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |