NME2 |
NME7 |
SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
||
[nonmetastatic cells 6; protein expressed in nonmetastatic cells 6] The human gene has been cloned by Mehus et al (1999) and Tsuiki et al (1999). The encoded protein is a member of the nucleoside diphosphate kinase family of proteins and is known also as nm23-H6 [nonmetastatic gene 23 homolog 6] (Tsuiki et al, 1999) (see also: nm23) or Nucleoside diphosphate kinase 6 [NDP kinase 6]. Tsuiki et al (1999) have reported that NME6 can undergo autophosphorylation. The autophosphorylated protein shows phosphotransferase activity and is capable of transferring the gamma-phosphate from ATP to CDP. Overexpression of NME6 in
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |