Nckalpha |
NCKAP1L |
KQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI |
||
[Nck-associated protein-1] The gene encoding NCKAP1 has been identified by Suzuki et al (2000) by virtue of its markedly reduced expression in most of the Alzheimer disease-affected brains examined. The protein (1,128 amino acids) shares 99.2 % amino acid sequence identity with rat Nap1 [Nck-associated protein-1] and has been referred to also as Nck-associated protein 125 kDa.
NCKAP1 is a predicted type 2 transmembrane protein, with a C-terminal transmembrane domain. NCKAP1 transcripts are detected in all tissues examined except peripheral blood leukocytes. Highest expression is seen in brain (predominantly in neurons), heart, and skeletal muscle (Suzuki et al, 2000).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |