Neurite retraction factor |
Neuritin 1 |
SYSRYRKQMAVKKYLAAVLGKRYKQRVKNK |
||
abbr. NRN. Called also Neuritin 1 (gene symbol NRN1). The cDNAs encoding the GPI-anchored protein neuritin have been isolated by Naeve et al (1997) from a kainate-activated rat hippocampal dentate gyrus library and a human cortical cDNA library. The mature rat and human proteins are 100 % identical. Neuritin is identical with CPG15 [Candidate Plasticity Gene 15] an activity-regulated gene that is expressed in the developing motor neurons (Nedivi et al, 1993, 1998).
The expression of neuritin is induced by the neurotrophins BDNF and NT-3
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |