COPE Advertising options



Previous Next
Search COPE:
 


- P -

Select one of the following:


p

P1
P1 antigen
P1-cells
P1 oncogenerative cells
P1 synthase
P1H12

P2
P2 myelin
P2-RANTES

P3H1
P-3E10 antigen

P4

P5CS

P6
P6Q peptide

P7 peptide
P7B2
p7 viroporin

p9Ka

p11
p11 BID
P12 peptide
p13
p13 BID
P13 II protein
p14ARF(1-22)
p15 BID
P15 peptide
P15-Tat
p15-TIA-1
P16
p16 IL3 inhibitor
p17
P17 peptide
p18
P18 peptide
p19
p19/nm23

p20Bap31
p20K
p22 BID
p22HBP
p23
p23 protein
p23/Tmp21
p24
p24delta1
p24 family protein delta-1
p27
p28
p28/CLF
p28ING5
p28/p40
P28 peptide
p29
p29 autoantigen
p29 estrogen receptor-associated protein
p29ING4

P-30 antigen
p32
p32 splicing factor SF2-associated protein
p33ING1
p33ING2
p33pim
p35
p35A
p35-binding protein
p35-related gene
p36
p36K
p38

P40
p40BBP
p40 Laminin-binding protein precursor
p40-TIA-1
p42MAPK
p43
p43 apoptosis-released factor
p43(ARF)
p43FLIP
p43 placenta isoferritin
p43-PLF
p44ERK1
p44MAPK
p47ING3
P48
P49

p52/p75
p52rIPK
p53AIP1
p53 apoptosis effector related to PMP-22
p53-binding protein-1
p53-binding protein-2
p53BP2
p53CSV
p53-induced CD28-dependent T-cell apoptosis
p53-induced gene 1
p53-induced gene-3
p53-induced gene 8
p53 induced protein with a death domain
p53-inducible cell-survival factor
p53RDL1
p53-regulated apoptosis-inducing protein 1
p53-regulated receptor for death and life 1
p53-responsive gene 2
p53-responsive gene 3
p53 upregulated modulator of apoptosis
p54(Ca)p
p55-R
p55TNFR
p55 TNF receptor
p56lck
P57
p58
p58 inhibitor of protein kinase
p58IPK
p58IPK-interacting protein
p58 repressor
p59OASL

p60
p60 TNF receptor
p63
p63/LMP
p65
p65-interacting inhibitor of NF-kappa-B
p66-mot-1
p67
p67eIF2
p67MAG
p69 oligoadenylate synthetase

p71 oligoadenylate synthetase
p72MAG
p75
p75/AIRM1
p75-like apoptosis-inducing death domain protein
p75LNGFR
p75 low affinity NGF receptor
p75 neurotrophin receptor
p75NGFR
p75NTR
p75NTR-associated cell death executor
p75NTR-associated cell death executor 2
p75NTR-associated cell death executor 3
p75NTR-associated cell death executor 4
p75NTR-associated cell death executor 5
p75TNFR

P80
p80-Amot
p80-angiomotin
p84
p84N5
p85-alpha

p91
p96PIF
p97
p97 melanoma antigen

p100/p52
p105 Basement membrane autoantigen
p105/p50
p113
P-113
p120GAP
p120 Ras GTPase-activating protein
p122-RhoGAP
p122 Rho GTPase-activating protein
P126
p130-Amot
p130-angiomotin
p146
p150
P-153
p155
p158-ron
p160 peptide
p161
p180
p180erbB3
p185erbB2
p185neu
P198

p200 family
p200 X domain
p202
p204
p260

P3.58

P422
P467 RHIPU
p48.2

P500
p50.1
p50.2
P518
P546 AMBCA
p58.1
p58.2
p58.3

P600

P815 cells

P974 AMBCA
P983 AMBCA
P985 AMBPA
P991 AMBCA

P1180 AMBTR
P1156
P1181 AMBMA
P1182 AMBMA
P1183 AMBTR
P1243

p71/73

p150,95

p220/240

p53(12-26)

P61458(35-60)

PA6
PA22-2 peptide
PA2.26
PAAD
PAAD and NACHT-containing protein 1
PAAD and NACHT-containing protein 2
PAAD and NACHT-containing protein 3
PAAD and NACHT-containing protein 4
PAAD and NACHT-containing protein 5
PAAD and NACHT-containing protein 6
PAAD and NACHT-containing protein 7
PAAD and NACHT-containing protein 8
PAAD and NACHT-containing protein 10
PAAD and NACHT-containing protein 11
PAAD and NACHT-containing protein 12
PAAD and NACHT-containing protein 13
Pa-AMP-1
PAAVRSPAQILQ
PABA peptide hydrolase
PAC1
PAC1n
PAC1normal
PAC1s
PAC1short
PAC1vs
PAC1very short
PACAP
Pacap
PACAP27
PACAP38
PACAP(1-27)
PACAP(1-38)
PACAP(1-38) binding factor
PACAP(6-38)
PACAP(9-38)
PACAP(111-128)
PACAPergic neurons
PACAPR
PACAPR1
PACAP-R2
PACAP-R3
PACAP receptor
PACAP receptor 1
PACAP receptor 2
PACAP receptor 3
PACAP-related peptide
PACAP-responsive gene-1
PACAP type 1 receptor
PACAP type 2 receptor
PACAP type 3 receptor
PACAP/VIP1 receptor
PACAP/VIP2 receptor
pacemaker cells
pacemaker neurons
Pachymatismin
Pachymodulin
PACSR
PAD3
PADGEM
PADI3
PAECs
PAELR
PAEL receptor
PAEP
PAF
PAFP-S
PAFSPWGamide
pag
PAG
PAG 1
PAGA
PAGASCLLLTSEIDLP
PAGASRLLLLTGEIDLP
PAGC
PAGE-5
Paget disease of bone 2
pagN
PAI
PAI-1
PAI-1-derived peptide
PAI-1DP
PAI-2
PAI-1(346-363)
PAI-1(350-355)
PAIBP
paired box domain
paired domain
paired immunoglobulin-like receptor B
Palate lung and nasal carcinoma-like protein
palate lung and nasal epithelium clone
PALB
Palifermin
PALIPFPRVamide
PALLAGGDDAEADEATELQQ
PALMD
palmdelphin
palmitate-induced cell death
PALML
palustrin-1
Palustrin-1a
Palustrin-1b
Palustrin-1c
Palustrin-1d
palustrin-2
Palustrin-2a
palustrin-2AJ1
palustrin-2AJ2
Palustrin-2ARa
Palustrin-2b
Palustrin-2c
palustrin-2CBa
Palustrin-2CE
palustrin-2CHa
palustrin-2ISa
palustrin-2ISb
palustrin-2LTa
palustrin-2Oa
palustrin-3
palustrin-3a
palustrin-3b
Palustrin-OG1
Palustrin-OG2
palustrins
PAM-1
PAMP
PAMP-12
PAMP-16
PAMP-20
PAMP(1-20)
PAMP(9-20)
PAMPs
PAMs
PAN1
PAN2
PAN3
PAN4
PAN5
PAN6
PAN7
PAN8
PAN10
PAN11
PAN12
PAN13
pan-B-cell antigen
pan-caspase inhibitors
Pancortin
Pancortin-1
Pancortin-2
Pancortin-3
Pancortin-4
Pancortins
pancreas-derived pathfinder cells
Pancreastatin
pancreastatin-29
pancreastatin-48
pancreastatin-52
pancreastatin-92
pancreastatin-186
pancreatic acinar cells
Pancreatic adenocarcinoma up-regulated factor
Pancreatic B-cells
Pancreatic Beta Cell Growth Factor
Pancreatic cancer-derived motility factor
pancreatic derived factor
Pancreatic ghrelin cells
pancreatic icosapeptide
Pancreatic lysophospholipase
pancreatic polypeptide
pancreatic polypeptide cells
pancreatic progenitor cell differentiation and proliferation factor
Pancreatic secretory factor
pancreatic secretory trypsin inhibitor
pancreatic secretory trypsin inhibitor-1
pancreatic secretory trypsin inhibitor-2
pancreatic secretory trypsin inhibitor-3
pancreatic secretory trypsin inhibitor-56
pancreatic secretory trypsin inhibitor-61
pancreatic stellate cells
Pancreatic stone protein
Pancreatic stone protein 2
Pancreatic thread protein
Pancreatic thread protein 2
pancreatic-type glucagon
pancreatitis-associated protein
pancreatitis-associated protein-1
pancreatitis-associated protein-1B
pancreatitis-associated protein-2
pancreatitis-associated protein-3
pancreatitis-associated protein(147-162)
pancreatitis-associated thread protein
pancreatoids
pancreatospheres
pancreozymin
PANDER
Pandinin-1
Pandinin-2
Pandinins
panepithelial glycoprotein 314
Paneth cell alpha-Defensins
Paneth cell defensins
Paneth cells
pan-hematopoietic expression gene X
Pan-Neurotrophin-1
pannocytes
PANO
PANO1
PANoptosis
PANoptosomes
Panorex
panspecific hemopoietin
P antigen family member 5
Pantinin-1
Pantinin-2
Pantinin-3
Pantinins
Panton-Valentine leukocidin
Panurgine-1
Panurgine-K
Panurgine-R
Panurgines
Paol-SCYA104
PAP
PAP1
PAP-1
PAP-2
PAP-3
PAP-4
PAP(147-162)
PAP(248-286)
papain-like protease 2
PAPB
PAPC
PAPep
PAP IB
Papilin
Papilin(33-51)
Papilin(391-408)
papiliocin
papillary thyroid carcinoma
papillaspheres
papilloma virus E2 protein
papilloma virus E5 protein
papilloma virus E6 protein
papilloma virus E7 protein
papillosin
Papilostatin-1
Papilostatin-2
Papilostatins
PAPIN
PAPLN
PAPP-A
PAPP-A2
pappalysin-1
pappalysin-2
pappalysins
PAPP-E
PAQR1
PAQR2
PAR-1
par-1
PAR2
par-2
PAR2-activating peptides
par-3
par-4
par-4/p33
par-4/p38
par-5
Paraaortic splanchnopleura
parabutoporin
paracaspase-1
paracaspase-1a
paracaspase-1b
paracaspase-2
paracaspase-3
paracaspases
Paracentrin 1
Paraciticidal peptides Dictionary
paraclones
Paracrine
Paracrine growth-stimulatory factor
paracrine lysis
paracrines
parafollicular cells
paraganglioma
Paraganglionic cells
Paragonial peptide B
paragranulin
Parainfluenza virus 2 V protein
Parainfluenza virus 5 V protein
paralemmin-like
parallel fibers
paralog
paralytic peptide
paralytic peptide-1
Paramecium bursaria Chlorella virus 1 Kcv protein
Paramyxovirus V protein
paraneoplastic antigen ma4
paraneoplastic encephalomyelitis antigen
paraneoplastic limbic encephalitis antigen 21
paraneuronal cells
paraneurons
paraoxonase-2
Parapoxvirus of red deer in New Zealand chemokine binding protein ORF112.0
Parapoxvirus of red deer in New Zealand chemokine binding protein ORF112.3
Parapoxvirus of red deer in New Zealand chemokine binding protein ORF112.6
paraptosis
Parasin-1
parasite-derived neurotrophic factor
Parasite-induced macrophage novel gene 1 protein
Parasol cells
parasol ganglion cells
Parastatin
ParaT
Parathormone
parathymosin
Parathymosin-alpha
parathyrin
parathyroid chief cells
parathyroid hormone
parathyroid hormone 1
parathyroid hormone 1 receptor
parathyroid hormone 2
Parathyroid hormone 2 receptor
Parathyroid hormone 4
parathyroid hormone(1-34)
parathyroid hormone-like hormone
Parathyroid hormone-like protein
parathyroid hormone-like related protein
parathyroid hormone-like related protein(1-36)
parathyroid hormone-like related protein(38-94)
parathyroid hormone-like related protein(107-139)
Parathyroid hormone-related protein(107-111)
Parathyroid hormone-related protein(107-139)
parathyroid hormone receptor
parathyroid hormone receptor 1
Parathyroid hormone receptor 2
parathyroid hormone-related peptide
parathyroid hormone-related protein
Parathyroid secretory protein
Parathyroid secretory protein-1
paravascular cells
PARC
PARCS
Pardaxin
parenchymal cells
parenchymal hepatic cells
parenchymal liver cells
parenchymatous cells of Baber
PARI
parietal cells
PARK2
PARK8
Parkerin
Parkin
parkin-associated endothelin receptor-like receptor
Parkinson disease-8
Parkinson disease protein 2
Parkinson juvenile disease protein 2
parkinson protein 2
PARL
PARM-1
PAR-mediated cell death
Parotid secretory protein
Parotid secretory protein(141-153)
PARP
PARP1
PARP1 binding protein
PARP1-dependent cell death
PARP5b
PARP6
PARP13
PARP13.1
PARP13.2
PARPBP
PARP cleavage protease
PARS
Parstatin
Parstatin(1-26)
Parthanatos
partitioning apoptosis
partner of burs
parvalbumin-beta
parvalbuminergic neurons
parvalbumin neurons
PARV neurons
parvocellular neurosecretory cells
Parvovirus initiation factor p96
PAS2
PAS 2
PAS 2'
PAS-4 protein
PaSCs
PASIV
PASMC
Passiflora edulis antifungal peptide-1
Pasteurella haemolytica leukotoxin
Pasteurella multocida dermonecrotic toxin
Pasteurella multocida mitogenic toxin
Pasteurella multocida toxin
pAT464
pAT744
PAT
Patch
patched
patched-1
patched-2
patched homolog 1
patched homolog 2
paternally expressed gene 3
pathfinder cells
pathogen-associated molecular patterns
pathogen-elicited epithelial chemoattractant
Pathogenicity/Virulence Factors Dictionary
pathogen recognition receptors
PATP
Patrolling monocytes
pattern recognition molecules
pattern recognition protein
Pattern recognition receptor Dictionary
pattern recognition receptors
paucity of lymph node T-cells
PAUF
Paul V. Lehmann
pavement cells
PAWR
PAX

pb
PB
p-B
PB1
PB-1
PB1 domain
PB1-F2
PBAN
PBAN-1
PBAN/pyrokinin family
PB-CKR
PBCV-1 Kcv
PBDX
PBEF
PBEF1
PBF
PBG1
PBGF
PB-IPC
p blast cells
PBLs
PBMCs
PBMNCs
pBMP9
P-bodies
PBP
PBP10
PBP1-6
PBP74
PBPC
PBP-like
PBSC
PBSF
pburs

PC-1
PC-3
PC3-secreted microprotein
PC-4
PC4 and SFRS1 interacting protein 1
PC4 and SFRS1 interacting protein 2
PC9
PC12
PC13 embryonal carcinoma-derived growth factor
PC3-96
Pca-1
PCASP1
PCASP1a
PCASP1b
PCASP2
PCASP3
PCB-binding protein
PCBBP
PCBD1
PCBD1(35-60)
PCBP
PCD
pcd
pCD25
PCDGF
PC cell-derived growth factor
P cells
P cell stimulating activity
P cell stimulating factor
PCF
PCFC
PCGF4
PCI-50-derived growth-promoting activity
PCI domain
PCINP
PC II-NP
PCK3145
PCKNFFWKTFSSCK
PCLP
PCLP1
PCM.1 peptide
PCM-binding peptide
PCMOs
PC motif
PCNA-Associated Recombination Inhibitor
P-component
PCP
PCPH
PCP1
PCPNI
PCPV VEGF
PCPV(VR634)VEGF
PCR
PCRP
PCR quantitation of cytokines
PCSA
PCSF
PCSK1N
PCSK9
PCT
PCTA
PCTA1
PCT-GF
PC-TRP
PCTT
PCWH

PD-1
PD-1-alpha
PD-1-beta
P/D1 cells
PD-1H
PD-1 homolog
PD-1 ligand 1
PD-1 ligand 2
PDAF
PDAP1
PDAPRIKKIVQKKLAGDESAD
PDB2
PDBu
PDC213
PDCs
PDCA-1
PDCD1
PDCD1L1
PDCD1L2
PDCD1LG1
PDCD1LG2
PDCD1 Ligand 1
PDCD1 Ligand 2
PDCD2
PDCD2L
PDCD4
PDCD5
PDCD6
PDCD6IP
PDCD6 interacting protein
PDCD7
PDCD8
PDCD9
PDCD10
PDCD11
PDCD12
PD-ECGF
PDF
PDF neurons
PDGF
PDGF-1
PDGF-2
PDGF-A
PDGF-AA
PDGF-AB
PDGF- and VEGF-receptor related
PDGF-associated protein
PDGF-associated protein 1
PDGF-B
PDGF-BB
PDGF-C
PDGF-CC
PDGF-D
PDGF-DD
PDGF family
PDGFR
PDGFR1
PDGFR2
PDGFRA
PDGFR-alpha
PDGFRB
PDGFR-beta
PDGF receptor
PDGF receptor-1
PDGF receptor-2
PDGF receptor-alpha
PDGF receptor-beta
PDGF-receptor beta-like tumor suppressor
PDGFRL
PDGF receptor-like
PDGF/VEGF factor-1
PDGF/VEGF factor-2
PDGF/VEGF factor-3
PDGI
PDGI-alpha
PDGI-beta
PDI3
PDIA15
PDIA17
PDIA18
PDI-alpha
PDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
PDL1
PDL2
PDL cells
PDL-CTX
PDMBP
PDMF
PDMPs
PDN-21
PDN2-alpha
PDNF
PDNFMRFamide
PDNP1
PDNP2
PDNP3
P-domain
P-domain factors
PDPAKTAPKKKSKKAVT
PDPAKTAPKKGSKKAVTKA
PDPN
PDS
PDWHF
PDYN
PDZD2
PDZ domain
PDZ domain-containing protein 2
PDZ domain protein 1

PE-11
PEA15
PEA15B
PEA15(2-11)
pEADPNKFYGLMamide
Pe-AFP1
peanut-like-2
peanut-reactive urinary mucin
PEAP209-237
Pea-PVK-1
Pea-PVK-2
PEAR1
Pea-SKNacid
Pea-VEAacid 1
Pea-YLSamide
PEBP
PEBP1
PEBP4
PEBP1(9-25)
PEC-60
PECAM1
Pechrysin
PED
Pedal peptide
PEDF
PEDF34
PEDF44
PEDF(16-26)
PEDF(24-57)
PEDF(40-64)
PEDF(44-77)
PEDF(58-101)
PEDF(78-94)
PEDF(78-102)
PEDF(90-114)
PEDF(387-411)
PEDQELESLSAIEAELEKVAHQLQAL
pEDVDHVFLRFamide
PEEC
pEEDCK
pEEDSG
peewee
pEFDEYGHMRFamide
PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR
PEG3
PEGAVKPPANKYPIFFF
peg cells
Pegfilgrastim
pEHPamide
pEHWSHGWYPGamide
pEHWSYGLRPGamide
pEL98
P-element-induced wimpy testis-interacting small RNAs
Pelger-Huët cells
Pelle
Pelle-like protein kinase
pELNFSAGWamide
pELNFSPGWamide
pELNFSPNWamide
pELNFTPNWGTamide
pELNFTPWWamide
Pelophylaxin-1
Pelophylaxin-2
Pelophylaxin-2GY
Pelophylaxin-3
Pelophylaxin-4
Pelophylaxins
pelteobagrin
pELTFSPDWamide
pELTFSSGWGQamide
pELTFTPNWamide
pELTFTPNWGTamide
pELTFTPSWamide
pELTFTSSWGamide
pELTFTSTWGamide
pELYAFPRVamide
PEM
PEM87
Pembrolizumab
Pem SKI
Pem SKII
Pem SKIII
PEMT
PEN
PEN5
Pen(a)
Penaeidin
Penaeidin-1
Penaeidin-2
Penaeidin-2b
Penaeidin-2d
penaeidin-3
Penaeidin-3a
Penaeidin-3a.1
Penaeidin-3a.2
Penaeidin-3a.3
Penaeidin-3b
Penaeidin-3c
Penaeidin-3d
Penaeidin-3f
Penaeidin-3g
Penaeidin-3h
Penaeidin-3i
Penaeidin-3j
Penaeidin-3k
Penaeidin-3l
Penaeidin-3m
Penaeidin-3n
Penaeidin-4
Penaeidin-4a
Penaeidin-4c
Penaeidin-4d
Penaeidin-5
Penaeidin 2-1
Penaeidin 2-2
Penaeidin 2-4
Penaeidin 3-1
penaeidin 3-2
Penaeidin 4-1
Penaeidin 4-3
penaeidin 5-1
penaeidin 5-2
penaeidin 5-3
Penaeidin 3-11
penaeidins
Penaeus monodon Anti-lipopolysaccharide factor
Penaeus monodon Anti-lipopolysaccharide factor 1
Penaeus monodon Anti-lipopolysaccharide factor 2
Penaeus monodon Anti-lipopolysaccharide factor 3
Penaeus monodon Anti-lipopolysaccharide factor 4
Penaeus monodon Anti-lipopolysaccharide factor 5
Penaeus monodon inhibitor of apoptosis protein
Penaeus monodon sulfakinin 1
Penaeus monodon sulfakinin 2
Penaeus monodon sulfakinin 3
Penaeus monodon sulfakinins
Penaeus stylirostris hemocyanin C-terminal fragment 1
Penaeus stylirostris hemocyanin C-terminal fragment 2
Penaeus vannamei hemocyanin C-terminal fragment
Pen alloantigen
Pen(b)
Penetratin
penetratin(43-58)
penetrating peptides
PENK
PENK(1-73)
PENK(114-133)
PENK(119-159)
PENK(143-185)
PENK(198-207)
PENK(209-237)
PENK(210-231)
PENK(237-258)
PENK(239-260)
PENKB
P-EN neurons
pent
Pentadactylin
pentagastrin
pentagone
Pentamidine
Pentastatin-1
Pentastatin-2
Pentastatin-3
Pentastatins
Pentaxin-3
Pentinin
Pentoxifylline
pentraxin-1
pentraxin-2
Pentraxin-3
Pentraxin-3(100-104)
pentraxin-related gene rapidly induced by IL1-beta
PEP
Pep-1
Pep-1 peptide
PEP3
pep5
Pep42
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRH
Pepcan-12
Pepcan-14
Pepcan-15
Pepcan-16
Pepcan-17
Pepcan-18
Pepcan-19
Pepcan-20
Pepcan-21
Pepcan-22
Pepcan-23
Pepcans
PepFect 6
PEPI
PEPN
pEPPGGSKVILF
PEPr
pepR
Pep TGN
peptic cells
peptidase domain-containing protein 1
Peptidase inhibitor 3
Peptidase inhibitor 16
Peptidase M
peptidase P
peptidases
peptide 3
peptide 23
Peptide 769P
Peptide 3910
peptide analogue of thymulin
peptide B
Peptide B11
peptide binding protein 74
peptide bond hydrolases
peptide C
peptide-conjugated PMOs
Peptide elongation factor-1A
peptide endocannabinoid 12
peptide endocannabinoid 14
peptide endocannabinoid 15
peptide endocannabinoid 16
peptide endocannabinoid 17
peptide endocannabinoid 18
peptide endocannabinoid 19
peptide endocannabinoid 20
peptide endocannabinoid 21
peptide endocannabinoid 22
peptide endocannabinoid 23
peptide endocannabinoids
peptidergic neurons
peptide F8
peptide H
peptide HI
peptide histidine glycine
peptide histidine isoleucine
peptide histidine isoleucine amide-27-like peptide
Peptide histidine methioninamide 27
peptide histidine methionine
Peptide histidine valine
Peptide histidine valine 42
peptide histidine valine-(1-42)
Peptide hormone 1
Peptide hormone 2
Peptide hormone 3
Peptide hormone 4
peptide HRH
peptide III14-2
peptide leucine arginine
peptide-linked phosphorodiamidate Morpholino oligomers
Peptide Lv
peptide mimetics
Peptide MiniCOPE dictionary
peptide-morpholinos
peptide P1
peptide P7
Peptide regulatory factors
Peptide RoY
peptide SA12
Peptide SP
peptide spacer 4
peptide spacer 5
peptide T
Peptide TR
peptide tyrosine arginine
peptide tyrosine tyrosine
Peptide V
Peptide VL
Peptide YR
peptide YY
peptide YY-2
peptide YY(1-36)
peptide YY(3-36)
peptidoglycan recognition proteins
Peptidoglycan recognition protein 1
Peptidoglycan recognition protein 2
Peptidoglycan recognition protein 3
Peptidoglycan recognition protein 4
Peptidoglycan recognition protein I-alpha
Peptidoglycan recognition protein I-beta
Peptidoglycan recognition protein L
Peptidoglycan recognition protein L1
Peptidoglycan recognition protein L2
Peptidoglycan recognition protein LA
Peptidoglycan recognition protein LB
Peptidoglycan recognition protein LC
Peptidoglycan recognition protein LCa
Peptidoglycan recognition protein LCx
Peptidoglycan recognition protein LCy
Peptidoglycan recognition protein LD
Peptidoglycan recognition protein LE
Peptidoglycan recognition protein S
Peptidoglycan recognition protein SA
Peptidoglycan recognition protein SB1
Peptidoglycan recognition protein SB2
Peptidoglycan recognition protein SC1A
Peptidoglycan recognition protein SC1B
Peptidoglycan recognition protein SC2
Peptidoglycan recognition protein SD
Peptidylarginine deiminase-3
peptidyl arginine deiminase type 3
peptidyl dipeptidase A
peptidyl-dipeptidase A
Peptidyl-prolyl cis-trans-isomerase
Peptidyl-prolyl cis-trans isomerase(22-39)
Peptidyl-prolyl cis-trans isomerase(23-39)
Peptidyl-prolyl cis-trans isomerase(26-39
Peptidyl-prolyl cis-trans isomerase(63-92)
Peptidyl-prolyl cis-trans isomerase(84-100)
peptidyl-prolyl cis-trans isomerase A
peptidyl-prolyl cis-trans isomerase B
peptidylprolyl isomerase A
peptidylprolyl isomerase B
peptidyl-tRNA hydrolase 2
per
Per2
Percoll
Perforin
Perforin-1
Perforin-2
Perforin-enhancing protein
Perforins
pericapillary cells
pericardial cells
pericardial nephrocytes
pericyte-like mesenchymal liver cells
pericytes
periglomerular cells
periendothelial cells
periglomerular neurons
Perikinin I
Perikinin II
Perikinin III
Perikinin IV
Perikinin V
Perikinins
perilipin 2
Perinerin
perineural cells
perineurial cells
Perineurial glial cells
period
Period2
Period circadian protein 2
periodic acid/Schiff-positive band 4
periodic acid/Schiff-positive protein 4
Periodontal ligament-associated protein 1
Periodontal ligament cell chemotactic factor
Periodontal ligament cells
Periodontal ligament fibroblasts
Periostin
periostin(142-151)
periostin-like factor
peripheral antigen-expressing cells
peripheral blood insulin-producing cells
peripheral blood mononuclear cells
peripheral blood NK-cells
peripheral blood progenitor cells
peripheral blood stem cells
Peripheral Demyelinating Neuropathy, Central Dysmyelination, Waardenburg Syndrome, and Hirschsprung Disease
peripherally-converted regulatory T-cells
peripherally-converted Tregs
peripherally-derived regulatory T-cells
peripherally-derived Tregs
peripherally induced regulatory T-cells
peripherally induced Tregs
peripheral myelin protein-22
peripheral nerve sheath cells
peripheral perisynaptic glia
Peripheral stem cell separation
Periplaneta americana periviscerokinin-1
Periplaneta americana periviscerokinin-2
Periplanetasin-2
Periplanetasin-4
periplanetasin-5
Periplanetasins
periplanetin CC-1
periplanetin CC-2
Periplanetins
peripolar cells
perisinusoidal lipocytes
perisinusoidal liver cells
perisulfakinin
perisynaptic Schwann cells
perithelial cells
Peritoneal cytotoxic factor
peritoneal mast cells
peritubular factor that modulates Sertoli cell function
perivascular ancestors
Perivascular astrocytes
perivascular cells
perivascular epithelioid cells
perivascular fibroblasts
perivascular macrophages
perivascular melanocyte-like macrophages
perivascular microglia
perivascular multi-lineage progenitor cells
perivascular multipotent progenitor cells
perivascular-resident macrophage-like melanocytes
perivascular stromal cells
perivascular supporting cells
Periviscerokinin
periviscerokinin-1
periviscerokinin-2
periviscerokinins
perlecan domain IV peptide
permeability-enhancing peptide
permeability transition pore
peroxidasin
peroxidasin homolog
Peroxiredoxin-1
Peroxiredoxin-2
Peroxiredoxin-4
Peroxiredoxin-5
Peroxiredoxin-5(53-67)
Peroxiredoxin-5(205-213)
peroxisomal membrane protein 20
peroxisome autophagy
peroxisome proliferator-activated receptor-gamma-related protein
PERP
pERp1
Persephin
Persephin receptor
persephone
persistent neurons
persisting cells
Persisting cell stimulating activity
Persisting cell stimulating factor
Persulcatusin
Pes
PESCRG1
PESKY
pESSFHSWGamide
PEST
Peste
Pestivirus Erns protein
PETA-3
PET-cells
PETCM
PETH
petunia pistil thionin
Pev-kinin 1
Pev-kinin 2
Pev-kinin 3
Pev-kinin 4
Pev-kinin 5
Pev-kinin 6
Pev-kinins
pEVNFSPGWGTamide
pEVNFSPNWamide
pEVNFSPSWGN
PEVYIHPF
PEX domains
Pexiganan
Pexophagy
Peyer's patch M cells

PF
PF-1
PF-2
PF4
PF4(47-70)
PF4A
PF4-ALT
PF4 superfamily
PF4V1
PF4-var
PF4var(47-70)
PF-18
PF-382 inhibitory factor
PF-382 derived BFU-E growth inducer
PF[4-241]
PF4(58-70)
P-Factor
PFC
PFC-EA
PFCNAFTGCamide
pFE(22)
Pfeiffer syndrome
pfeRNAs
Pfi-013
PFKLSLHLamide
PFLWGLIPGAISAVTSLIKK
PFM11
PfMCA-1
PFN
PFN1
PFNFGLamide
PFNQGTFAS
PFP
pFQ(7)
PFR peptide
PFSEDVNWGYE
PfTyrRS
pFv
PFVYLI
PFWRIRIRRamide

PG-1
pG2
PG-2
PG-3
PG-4
PG40
PG(1-30)
PG155
PG(1-69)
PG(33-69)
PG(78-107)
PG(126-158)
PGAIPG
PGAR
PGAVGP
PGCs
PGC7
PG cells
PGF
PGFGAVPGA
PGH synthase 2
PGHS2
PG I
PGI
PGI2 stimulating factor
PGI2-stimulatory activity
PGIF
PG II
PGK1
PGKA
PGLa
PGLa-H
PGLLDLK
pGlu-His-Proamide
pGlu-serpinin
P-glycoprotein
P-glycoprotein-1
PGLYRP
PGLYRP-1
PGLYRP-2
PGLYRP-3
PGLYRP-4
PGLYRP-I-alpha
PGLYRP-I-beta
PGLYRPL
PG-M1
PG-M-CSF
PGP
PGP1
PGP1.1
pg/pg
PGPIPN
PGQ
PGR14
PGRL
PGRN
PGRP
PGRP-A
PGRP-B
PGRP-C
PGRP-D
PGRP domain
PGRPIA
PGRP-I-alpha
PGRPIB
PGRP-I-beta
PGRP-L
PGRP-L1
PGRP-L2
PGRP-LA
PGRP-LB
PGRP-LC
PGRP-LCa
PGRP-LCx
PGRP-LCy
PGRP-LD
PGRP-LE
PGRP-LF
PGRP-long
PGRP-S
PGRP-SA
PGRP-SB1
PGRP-SB2
PGRP-SC1A
PGRP-SC1B
PGRP-SC2
PGRP-SD
PGRP-short
PG-S1
PG-S2
PGSF
PGSF2
PGTCEICAYAACTGC
PGY1

pH2-labile interferon
pH2-stable interferon
Ph8 peptide
PH-30
PH-30-alpha
PH-30-beta
pH 34
ph91 antigen
PHACTR1
Phafin-1
Phafin-2
Phafins
phagocyte extracellular traps
phagocytes
phagocytic glycoprotein-1
phagocytic glycoprotein-1.1
phagocytic-histiocytic reticular cells
phagocytic immunocytes
Phagocytin
phagocytosis-augmenting factor
Phagocytosis-induced apoptosis
Phagocytosis-induced cell death
Phagocytosis inducing factor
phagocytosis-inhibiting lymphokine
phagophore
phagoptosis
phalangeal cells
phalanx cells
PHAP1
PHAPI
PHAQIPQRQYLPNSHPPTVVR
Phaseolus vulgaris defensin-1
phasic cells
phasic ganglion cells
phasic neurons
Phasic-tonic cells
Phasic-tonic neurons
phasvatocin
PHD2
phDCs
PH domain
PH domain-containing family F member 1
PH domain-containing family F member 2
Phe2,Arg8-vasopressin
Phe2-arginine-vasopressin
Phe2-mesotocin
Phe3,Asn4,Val8-oxytocin
Phe8-phyllolitorin
Phe-Ala-Leu-Pro-Gln-Tyr
Phe-Ala-Leu-Pro-Gln-Tyr-Leu-Lys
Phe-Arg-Ala-Asp-His-Pro-Phe-Leu
Phe-D-Asn-Glu-Phe-Valamide
Phe-Enkephalin
Phe-Gly-Leuamide
Phe-His-Pro-Lys-Arg-Pro-Trp-Ile-Leu
Phe-Leu-Gly-Phe-Pro-Thr
Phe-Leu-Gly-Phe-Pro-Thr-Thr-Lys-Thr-Tyr-Phe-Pro-His-Phe
Phe-Lys-Ile-Gly-Gly-Phe-Ile-Lys-Lys-Leu-Trp-Arg-Ser-Lys-Leu-Ala
Phe-Lys-Leu-Leu-Ser-His-Ser-Leu-Leu-Val-Thr-Leu-Ala-Ser-His-Leu-Pro
Phe-Met-Arg-Pheamide
PHEMX
Phenol soluble modulin alpha
Phenol-soluble modulin alpha 1
Phenol-soluble modulin alpha 2
Phenol-soluble modulin alpha 3
Phenol-soluble modulin alpha 4
Phenol soluble modulin beta
Phenol soluble modulin beta-1
Phenol soluble modulin beta-2
Phenol soluble modulin beta-3
Phenol soluble modulin gamma
Phenol-soluble modulin-mec
Phenol soluble modulins
phenoptosis
Phenylalanine hydroxylase-stimulating protein
Phenylalanine translase
Phenylalanine-tRNA ligase
phenylalanyl-tRNA synthetase
phenylalanyl-tRNA synthetase subunit alpha
phenylalanine-tRNA synthetase-like
phenylalanine-tRNA synthetase-like alpha
phenylalanine-tRNA synthetase-like beta
phenylalanyl-tRNA synthetase subunit beta
Phenylketophosphamide
phenylpyruvate keto-enol isomerase
phenylpyruvate tautomerase
Phenylpyruvate tautomerase(2-27)
Phenylpyruvate tautomerase(8-27)
Phenylpyruvate tautomerase(11-27)
Phenylpyruvate tautomerase(28-47)
Phenylpyruvate tautomerase(28-50)
Phenylpyruvate tautomerase(101-115)
Phenylpyruvate tautomerase II
Phenypressin
pheochrome cells
pheochromoblasts
pheochromocytes
pheochromocytoma
pheochromocytoma cell-3
pheochromocytoma cell-4
Phe-Phe-Ser-Asn-Lys
Phe-Phe-Thr-Thr-Ser-Cys-Arg-Ser-Gly-Cys
Phe-Phe-Val-Ala-Pro-Phe-Pro-Glu-Val-Phe-Gly-Lys
pheromone biosynthesis-activating neuropeptide
pheromone biosynthesis-activating neuropeptide 1
pheromonotropins
PheRS
PHERSB
Phe-Thr-Thr-Phe-Thr-Val-Thr
Phe-tRNA Synthetase
PHF cells
PHGPX
PHGQVVVAVRS
PHI
PHI-27
PHI-Gly
PHI/PHM
PHLDA1
PHLDA2
pHLIP
pHLIP variant 3
pHLIP variant 7
pH low insertion peptide
PHM
PHM-27
phoenixin-14amide
phoenixin-20amide
Phoenixin
phoenixin-26
phoenixin-36
phoenixin-42
phoenix rising
phorbol 12-myristate 13-acetate
phorbol-12-myristate-13-acetate-induced protein 1
Phorbol-12,13-dibutanoate
phorbol-12,13-dibutyrate
Phorbol dibutyrate
Phorbol esters
Phormicins
Phosphacan
Phosphatase Actin Regulating Protein-1
phosphatase and actin regulator-1
phosphatidylethanolamine binding protein
phosphatidylethanolamine binding protein-1
phosphatidylethanolamine binding protein-4
phosphatidylethanolamine binding protein(9-25)
Phosphatidylinositol-3-kinase 85 kDa regulatory subunit alpha
Phosphatidylinositol-glycan biosynthesis class T protein
Phosphatidylinositol transfer protein, membrane-associated 3
Phosphatidylserine
phosphatidylserine binding protein p68
phosphatonin
phosphaturic factor
Phosphodiesterase-1-beta
Phosphodiesterase-1/nucleotide pyrophosphatase
Phosphodiesterase-1/nucleotide pyrophosphatase-2
Phosphodiesterase nucleotide pyrophosphatase-1
Phosphodiesterase nucleotide pyrophosphatase-2
phosphodiesterase/nucleotide pyrophosphatase 3
phosphofructoaldolase
phosphoglucose isomerase
phosphoglycerate kinase
phosphoglycerate kinase 1
Phosphohexomutase
Phosphohexose isomerase
phosphoinositide-3-kinase regulatory subunit 1
Phospholipase A2 Induced DNA fragmentation factor released at 15th min
phospholipase D domain
Phospholipid hydroperoxide glutathione peroxidase
phosphoprotein 32
phosphoprotein 46
phosphoprotein enriched in diabetes
phosphoprotein enriched in astrocytes 15
phosphoprotein enriched in astrocytes 15(2-11)
phosphoprotein enriched in astrocytes 15B
phosphopyruvate hydratase
Phosphorodiamidate Morpholino oligomers
Phosphorylated N-glycoprotein
phosphorylcholine-binding protein
phosphotyrosine binding domain
phosphotyrosine phosphatase zeta
Phosvitin
phosvitin-derived peptide Pt5
phosvitin-derived peptide Pt5e
Photomedin-1
Photomedin-2
photoreceptor cells
photosensitive retinal ganglion cells
Phox and Bem1 domain
Phox homology domain
PHPC
PHS
PHSCs
PhT-3
PHV
PHV-42
PHV(1-42)
pHyde
Phyllokinin
Phyllolitorins
phylloseptin-1
phylloseptin-2
phylloseptin-3
phylloseptin-4
phylloseptin-5
phylloseptin-6
phylloseptin-7
phylloseptin-L2
Phylloseptin-PBa
Phylloseptin-PBu
phylloseptins
Phyllostachys pubescens antimicrobial peptide 1
Phyllostachys pubescens antimicrobial peptide 2
Phylloxin
Phylloxins
Physalaemin
physaliphorous cells
physiological DCs
physiological dendritic cells
phytohaemagglutinins
Phytolacca americana antimicrobial peptide-1
Phytolacca antifungal protein

PI1
PI3
PI4
PI5
PI9
PI10
PI13
PI16
PIA
PIAS
PIAS-1
PIAS-2
PIAS-3
PIAS-4
PIAS-gamma
PIAS-NY
PIASx-alpha
PIASx-beta
PIAS-y
PIBF
PIBF1
PIC1
PICA
PICA peptide
PICD
PICK1
Pick cells
picky
PICP
PICT-1
PID15
PIDD
PIDD1
PIDD1-C
PIDD1-CC
PIDD2
PIDD3
PIDD4
PIDDosome
PIE antigen
Piebaldism
Piecemeal degranulation
piecemeal necrosis
Pierisin
Pierisin-1
Pierisin-2
Pierisin-3
Pierisin-4
Pierisin-5
Pierisin-6
Pierisin-B
PIF
PIG1
PIG2
PIG3
PIG8
PIG15
Pig leukocyte cysteine proteinase inhibitor
pigment cells
pigment-concentrating hormones
pigment-dispersing factor
Pigment-dispersing factor homolog
pigment-dispersing hormones
Pigment epithelium-derived factor
Pigment Epithelium-Derived Factor 34mer
PIGT
PIgR3
PigT
PIIBNP
PIK3R1
pike parvalbumin
PIL
PIL-6
PILAR
pillar cells
Pilosulin-1
Pilosulin-2
Pilosulin-3
Pilosulin-4
Pilosulin-5
pilosulins
PILOT
PILS-AP
PilT-N terminal domains
Pim
pim-1
Pim-2
Pim-3
PiMM antitrypsin
PIN1
PIN2
PIN2/TRF1
pinacocytes
PIN domains
pineal cells
pinealocytes
pineocytes
pink adipocytes
pink fat cells
Pinocchio cells
Pinus sylvestris antimicrobial peptides
pioneer cells
pioneer factors
pioneer neurons
Pip
PIP
pip92
Pipinin-1
PIRB
piRNA-like small non-coding RNAs
piRNA-like sncRNAs
piRNA-Ls
piRNAs
PIRNWWIRIWEWLNGIRKRLRQRSPFYVRGHLNVTSTPQP
PISCF-allatostatins
Piscidin-1
Piscidin-1H
Piscidin-1N
Piscidin-2
Piscidin-2-beta
Piscidin-3
Piscidin-4
Piscidins
PiSS antitrypsin
Pit-1
pit cells
pitch cells
PITDs
Pitocin
PITPNM3
PITPNM family member 3
Pitrakinra
Pitressin
PITs
pituicytes
pituitary adenylate cyclase-activating polypeptide
pituitary adenylate cyclase-activating polypeptide1-38-binding factor
pituitary adenylate cyclase-activating polypeptide(6-38)
pituitary adenylate cyclase-activating polypeptide(24-41)
pituitary adenylate cyclase-activating polypeptide related peptide
pituitary adenylate cyclase-activating polypeptide responsive gene-1
Pituitary adenylate cyclase-activating polypeptide type 1 receptor
pituitary-adrenocortical axis
pituitary astrocytes
pituitary colony-forming cells
pituitary-derived chondrocyte growth factor
pituitary FGF
pituitary follicular cells
pituitary folliculo-stellate cells
Pituitary gland-specific factor 2
pituitary glial cells
pituitary growth factor
pituitary polypeptide 7B2
pituitary secretory protein-1
pituitary tumor apoptosis gene
pituitary tumor-transforming 1 interacting protein
Pituitary tumor-transforming gene 1 protein-interacting protein
Pituitary tumor-transforming gene protein-binding factor
Pituitrin P
pIXY321
piwi
Piwi-interacting RNAs
PIWIL1
piwi-like 1
PiZZ antitrypsin

P-JAM test

PK1
PK2
PK2 long form
PK-2
PK2-beta
PK2L
PK2-R1
PK2R1
PK2-R2
PK2R2
PK3
PK1-3
PK1-4
PK15
PK-120
PK3(2-18)
P(k) antigen synthase
Pkare
PKA-related protein kinase
PKC conserved region 1
PKC conserved region 2
PKC-delta-interacting protein kinase
PKCSH
PKDCC
PKENWVQRVVEKFLKRAENS
P(k) glycolipid
PKK
PKLLETFLSKWIG
PKM
PKM2
PKM(2-18)
PKM2(2-18)
PKMTs
PK/PBAN family
PKPDSEAGTAFIQTQQL
PKQTWVKYIVRLLSKKVKNM
PK-R1
PK-R2
PKRGFQD
pks island
PKX1

PL
PL74
PL-A
PL(A1)
PL(A2)
PLAB
PLAC1
PLAC8
PLAC9
place cells
place-by-direction cells
place neurons
Placenta derived apoptotic factor
placenta fragment assay
Placenta growth factor
Placenta growth factor-1
Placenta growth factor-2
Placenta growth factor-3
Placenta growth factor-4
placenta immunomodulatory ferritin
Placental angiogenic factor
placental anticoagulant protein
placental anticoagulant protein-1
placental anticoagulant protein 4
placental bikunin
Placental bone morphogenetic protein
Placental-derived mitogenic factor
Placental factor
Placental growth factor
Placental growth factor-1
Placental growth factor-2
Placental growth factor-3
Placental growth factor-4
placental growth hormone
placental isoferritin
placental lactogen
placental lactogen 1
placental lactogen(101-114)
placental lactogen A
placental lactogen B
Placental lactogen-I alpha
Placental lactogen-I beta
Placental lactogen-I gamma
placental lactogens
Placental Leucine Aminopeptidase
placental macrophages
placental plasminogen activator inhibitor
placental prolactin-like protein
Placental prolactin-like protein A
Placental prolactin-like protein B
Placental prolactin-like protein C
Placental prolactin-like protein D
Placental prolactin-like protein E
Placental prolactin-like protein F
Placental prolactin-like protein G
Placental prolactin-like protein H
Placental prolactin-like protein I
Placental prolactin-like protein J
Placental prolactin-like protein K
Placental prolactin-like protein L
Placental prolactin-like protein M
Placental prolactin-like protein N
Placental prolactin-like protein O
Placental prolactin-like protein P
placental protein-4
placental protein 5
placental protein 10
placental protein 11
Placental protein 11-related protein
placental protein 12
Placental Protein 13
Placental protein 13-like
placental protein 14
placental protein 14.1
placental protein 14.2
placental ribonuclease inhibitor
placental stem cells
Placental tissue protein 13
placental tissue protein 17
Placental Transforming Growth Factor-beta
placenta-specific 1
placenta-specific 8
Placenta-specific ATP-binding cassette transporter
placenta-specific protein 1
Placenta-specific protein 9
Placentin
placodal cells
placodes
PLAEIDGIELTY
PLAGL1
PLAIDD
PLAIDD-L
PLAIDD-S
plakophilin-related armadillo repeat protein-interacting PDZ protein
planar cell polarity
PLANH2
plantaricin A
plant defensins
plant/insect-type defensins
plant-specific insert
plant-specific sequence
P-LAP
PLAP-1
Plaque-associated microglia
Plaque forming cell enhancing factor
plasmablasts
plasma cell-induced ER protein 1
Plasma cell-induced resident endoplasmic reticulum protein
plasma cell membrane glycoprotein-1
plasma cells
plasma cell thioredoxin-related protein
Plasmacytes
plasmacytoid dendritic cells
plasmacytoid dendritic cell antigen-1
plasmacytoid monocytes
plasmacytoid predendritic cells
plasmacytoid T-cells
plasmacytoma
plasmacytoma cytotoxic factor
Plasmacytoma growth factor
plasmacytoma growth inhibitor
Plasmacytoma stimulatory activity
Plasmacytoma-derived suppressor factor
Plasma-derived serum
plasma fibronectin
Plasma kallikrein
Plasma kallikrein sensitive glycoprotein 120
plasma membrane blebs
plasma membrane calcium ATPase 4b
plasma precursor of monocyte chemotactic factor-2
Plasma prekallikrein
plasma retinol-binding protein
Plasmatocytes
plasmatocyte spreading peptide-1
plasminogen(759-778)
Plasminogen activator inhibitor
Plasminogen activator inhibitor-1
Plasminogen activator inhibitor-1 binding protein
Plasminogen activator inhibitor-2
Plasminogen activator inhibitor-1(346-363)
Plasminogen activator inhibitor-1(350-355)
plasminogen activator, tissue
plasminogen activator urokinase receptor
plasminogen activator urokinase receptor(84-95)
plasminogen kringles 1-3
plasminogen kringles 1-4
plasminogen kringles 1-5
plasminogen-like B1
plasminogen-related gene B
Plasminogen-related growth factors
Plasmocytes
Plasmodium circumsporozoite protein(76-93)
Plasmodium circumsporozoite protein(82-100)
Plasmodium falciparum metacaspase 1
Plasmodium falciparum Tyrosyl-tRNA synthetase
Plasticin-L1
plasticins
plasticity
PLAT
Platelet-activating factor
platelet activation dependent granule-external membrane protein
platelet activation factor
platelet adhesion molecule 1
platelet alpha-granule membrane protein
platelet and T-cell activation antigen 1
Platelet basic protein
platelet collagen receptor
Platelet-derived endothelial cell growth factor
Platelet-derived endothelial cell growth inhibitor
Platelet-derived endothelial cell mitogen
Platelet-derived growth factor
Platelet-derived growth factor-1
Platelet-derived growth factor-2
Platelet-derived growth factor-A
Platelet-derived growth factor-AA
Platelet-derived growth factor-AB
Platelet-derived growth factor-B
Platelet-derived growth factor-BB
Platelet-derived growth factor-C
Platelet-derived growth factor-CC
Platelet-derived growth factor-D
platelet-derived growth factor family
Platelet-derived growth inhibitor
platelet derived growth inhibitor-alpha
platelet derived growth inhibitor-beta
platelet-derived macrophage-binding proteoglycan
platelet-derived microparticles
Platelet-derived wound healing formula
platelet dust
platelet endothelial aggregation receptor 1
platelet-endothelial cell adhesion molecule 1
platelet-endothelial cell tetraspan antigen 3
Platelet F11 receptor
Platelet factor-4
platelet factor-4 alternate
Platelet factor-4 superfamily
platelet factor-4 variant 1
platelet factor-4(47-70)
platelet factor-4(58-70)
platelet fibrinogen receptor beta subunit
platelet glycoprotein Ia
platelet glycoprotein Ia/IIa
platelet glycoprotein Ib alpha
Platelet glycoprotein Ib-beta
platelet glycoprotein Ic
platelet glycoprotein Ic*
platelet glycoprotein IIb
platelet glycoprotein IIIa
platelet glycoprotein IIIb
platelet glycoprotein 4
platelet glycoprotein 9
platelet glycoprotein gp40
platelet gpI
platelet lytic factor
Platelet microbicidal protein
Platelet microbicidal protein 1
platelet microparticles
Platelet-poor plasma
platelet protein GPIIa
platelet proteoglycan
platelet proteoglycan protein core
platelets
PLAUR
PLAUR(84-95)
PLA-X polypeptide
PL-B
PLCPI
Plcrustin1
Plcrustin2
Plcrustin3
PLD domain
PLDSQSIYQLIEI
PLDSVYGTHGMSGFA
PLE21
Pleckstrin homology domain
Pleckstrin homology domain-containing family F member 1
Pleckstrin homology domain-containing family F member 2
pleckstrin-homology-like domain family A member1
pleckstrin homology-like domain family A member 2
Plectasin
Pleiotrophic factor-alpha-1
Pleiotrophin
PLEKHF1
PLEKHF2
Pleomorphic adenoma gene-like-1
pleurain-A
Pleurain-A1
Pleurain-a1-thel
Pleurain-A2
Pleurain-A3
Pleurain-A4
Pleurocidin
Pleurocidin 01
Pleurocidin 02
Pleurocidin 03
Pleurocidin 04
Pleurocidin 05
Pleurocidin 06
Pleurocidin 07
Pleurocidin 08
Pleurocidin 09
Pleurocidin 10
Pleurocidin 11
Pleurocidin 12
Pleurocidin 13
Pleurocidin 14
Pleurocidin 15
Pleurocidin 16
Pleurocidin 17
Pleurocidin 18
Pleurocidin 19
Pleurocidin 20
pleurocidin-like peptides
Pleurocidin NRC-01
Pleurocidin NRC-02
Pleurocidin NRC-03
Pleurocidin NRC-04
Pleurocidin NRC-05
Pleurocidin NRC-06
Pleurocidin NRC-07
Pleurocidin NRC-08
Pleurocidin NRC-09
Pleurocidin NRC-10
Pleurocidin NRC-11
Pleurocidin NRC-12
Pleurocidin NRC-13
Pleurocidin NRC-14
Pleurocidin NRC-15
Pleurocidin NRC-16
Pleurocidin NRC-17
Pleurocidin NRC-18
Pleurocidin NRC-19
Pleurocidin NRC-20
plexA
PLEXA1
PLEXA4
plexB
PLEXD1
Plexin
Plexin-1
Plexin-2
Plexin-3
Plexin-4
Plexin-5
Plexin-6
Plexin-A
Plexin-A1
Plexin-A2
Plexin-A3
Plexin-A4
Plexin-B
Plexin-B1
Plexin-B2
Plexin-B3
Plexin-C1
Plexin-D1
Plexin domain containing 1
Plexin domain containing 2
plexin domain containing 3
plexin domain containing 7
Plexin domain-containing protein 1
Plexin domain-containing protein 2
Plexin domain-containing protein 3
Plexin domain-containing protein 7
Plexins
PLEXR
PLF
PLF1
PLF2
PLF3
PLF4
PLF-RP
PLG
PLGamide
PlGF
PlGF-1
PlGF-2
PlGF-3
PlGF-4
PlgK1-3
PlgK1-4
PlgK1-5
PLGLB1
PLIF
PLIN2
plithotaxis
Plk
Plk-1
PLK4
PLLQATAGGGS
PLLQATL
pLM59
PLNHR
PLMRLEEYKKEQAINRAGIVQEDVQPPGLKVWSDP
PLP
PLP2
PLP-A
PLP-B
PLP-C
PLP-Calpha
PLP-Cbeta
PLP-Cdelta
PLP-Cgamma
PLP-Cv
PLP-D
PLP-E
PLP-F
PLP-Fa
PLP-F alpha
PLP-Fb
PLP-F beta
PLP-G
PLP-H
PLP-I
PLP-J
PLP-K
Plpk
PLP-L
PLP-M
PLP-N
PLP-O
PLP-P
PLPSKETIEQEKQAGES
pLR
PLSC
plt
PLTGP40
PLU-1
PLUNC
Pluripoietin
Pluripoietin-alpha
Pluripoietin-beta
pluripotency
pluripotency factors
pluripotent colony stimulating factor
pluripotent cells
pluripotent colony stimulating factor-alpha
pluripotent colony stimulating factor-beta
pluripotent embryonic stem cell-related gene
pluripotent embryonic stem cell-related gene 1 protein
pluripotent hematopoietic stem cells
pluripotent lymphoid stem cells
pluripotent stem cells
Pluripotential stem cell-supporting factor
PLXDC1
PLXDC2
PLXN1
PLXN2
PLXN4
PLXN5
PLXN6
PLXNA1
PLXNA2
PLXNA3
PLXNA4
PLXNB1
PLXNB2
PLXNB3
PLXNC1
PLXND1
PLYGGDRRFSFGLamide
PLYKKIIKKLLES
P lymphocytes

PM
p-M
PM-1k
PMA
PMA-induced protein 1
PMAIP1
PMAP-23
PMAP-36
p-MB
PMCA4b
PMCs
PMCFS-1
PMCH
PMDT
PMEM
PMEPA1
p-METB
PMFA
PMFIVNTNVPRASVPEGFLSELTQQL
PmIAP
PMLs
PML competitor for TGIF association
PML interacting clone-1
PML nuclear bodies
PML oncogenic domains
PMNs
PMN7
PMN-CCF
PMN-derived lymphocyte proliferation-potentiating factor
PMN factor
Pmng1
PMNL collagenase
PMNL gelatinase
PMNL recruiting activity
PMNL recruiting factor
PMNMLRLamide
P-Mod-S
PMOs
PMP
PMP-1
PMP-1a
PMP20
PMP22
PMPs
PMPVSQECFETLRGHERILSILRHQNLLKELQDLALQGAKERAHQQ
PMRLRWamide
PM/Scl-100
PMSG
PMSMLRLamide
PMT
p-MT
p-MTB
p-Multi
PMVAGGGCFGMKMDRIGSISGLGC

PN-1
PN-1-alpha
PN-1-beta
PN2
PNAS-2
PNAS4
PNC-27
pncRNAs
PND
pneumocytes
Pneumo secretory protein 1
Pneumo secretory protein 2
pneumospheres
PNFTQHVREQSLV
PN II
PNMA4
pNK-cells
Pno
PNOC
PNP
PnSP-1
PnSP-2
PNT
PNT-1
PNT domain
PNUTL-2
PNX
PNX-14
PNX-20
PNX-26
PNX-36
PNX-42

po
Po66 carbohydrate-binding protein
Po66-CBP
POC
podocalyxin
podocalyxin-like
podocalyxin-like protein
podocalyxin-like protein 1
podocytes
Podoplanin
PODs
PODXL
POEM
POF
poikilocytes
pointed domain
Polae-PVK-1
Polae-PVK-2
polar cushion cells
polarized astrocytes
polarized astroglial cells
polarized B effector cells
polarized cells
polarized degranulation
polarized Kupffer cells
polarized macrophages
polarized microglial cells
polarized neutrophils
polarized T-cells
POLCs
PolIII
Poliovirus protein 2B
Poliovirus protein 2BC
poliovirus receptor
Poliovirus receptor-like-1
Poliovirus receptor-like-2
poliovirus receptor-related
poliovirus receptor-related-1
poliovirus receptor-related-2
poliovirus receptor-related-3
Poliovirus Sensitivity
Polkissen cells
polo
polo-like kinase
polo-like kinase-1
polo-like kinase 4
poly(ADP-ribose)-mediated cell death
poly(ADP-ribose) polymerase
poly(ADP-ribose) polymerase 1
poly(ADP-ribose) polymerase 1-dependent cell death
poly(ADP-ribose) polymerase 5b
poly(ADP-ribose) polymerase 6
poly(ADP-ribose) polymerase 13
poly(ADP-ribose) synthetase
poly-arginine
Polyaxonal amacrine cells
Polybia-CP
Polybia-MPI
polyblasts
poly-caspase inhibitors
polychlorinated biphenyl-binding protein
polychromatic cells
polychromatic erythroblasts
polychromatic normoblasts
polychromatophilic erythroblasts
polychromatophilic megaloblasts
polychromatophilic normoblasts
polychromatophilic red blood cells
polycomb group ring finger 4
polycythemia rubra vera 1
polydendrocytes
Polydim-I
Polydom
Polyergin
Poly-Ig receptor 3
polykaryocytes
Polymeric immunoglobulin receptor 3
polymorphic epithelial mucin
polymorphonuclear cell crystal induced chemotactic factor
polymorphonuclear cells
polymorphonuclear leukocyte antigen 7
polymorphonuclear leukocyte collagenase
Polymorphonuclear leukocyte-derived lymphocyte proliferation-potentiating factor
polymorphonuclear leukocyte gelatinase
polymorphonuclear leukocyte recruiting activity
polymorphonuclear leukocyte recruiting factor
polymorphonuclear leukocytes
polymorphonucleocytes
polypedarelaxin 1
polypedatein
polypeptide elongation factor 1
polypeptide S1
polyphemusin-1
polyphemusin-2
Polyphemusin-3
polyphemusins
polysialylated NCAM
Polyspilota aeruginosa periviscerokinin-1
Polyspilota aeruginosa periviscerokinin-2
Poly(U)-specific endoribonuclease
POMC
POMC(77-87)
POMC(77-88)
POMC(27-102)
POMC(138-176)
POMC(156-176)
POMC(179-234)
POMC(179-267)
POMC(217-234)
POMC(237-241)
POMC(237-267)
POMC cells
POMC neurons
Pomegranin
POMFIL1
POMFIL2
POMFIL3
PON2
Ponericin G
Ponericin-G1
Ponericin-G2
Ponericin-G3
Ponericin-G4
Ponericin-G5
Ponericin-G6
Ponericin-G7
Ponericin L
Ponericin-L1
Ponericin-L2
Ponericins
Ponericin W
Ponericin-W1
Ponericin-W2
Ponericin-W3
Ponericin-W4
Ponericin-W5
Ponericin-W6
POP-1
POP-2
popcorn cells
POR 8
porcine myeloid antimicrobial peptide-23
porcine myeloid antimicrobial peptide-36
pore cells
Pore-forming protein
Pore-forming protein-1
pore-forming protein-2
pore-induced intracellular traps
Pore membrane and/or filament-interacting-like protein 1
Pore membrane and/or filament-interacting-like protein 2
Pore membrane and/or filament interacting like protein 3
Porflan
Porimin
Portunus trituberculatus Anti-lipopolysaccharide factor
Portunus trituberculatus Anti-lipopolysaccharide factor 1
Portunus trituberculatus Anti-lipopolysaccharide factor 2
Portunus trituberculatus Anti-lipopolysaccharide factor 3
positive acute phase reactants
Positive chemotaxis
Positive regulatory domain I-binding factor 1
post-apoptotic necrosis
post-apoptotic necrotic cell death
post-apoptotic secondary necrosis
postaxial hemimelia
Posterior Alpha/Beta-Kenyon cells
posterior horn cells
posterior signaling centre cells
post-gamma globulin
post-isolation interval and culture passage cells
postmitotic apoptosis
postmitotic cells
POSTN
postnatal vasculogenesis
posttherapeutic stem cells
post-transcriptional gene silencing
POT1
potamin-1
potassium channel-interacting protein 3
potential stem cells
Potide-G
POU5F1
POU5F1P1
POU5F1P3
POU5F1P4
POU5F1P5
POU5F1 pseudogene 1
POU5F1 pseudogene 3
POU5F1 pseudogene 4
POU5F1 pseudogene 5
POU class 5 homeobox 1
POU domain class 5 transcription factor 1
Pouterin
Pox virus E10R
Poxvirus A46 protein
Poxvirus A52R protein
Poxvirus E10R protein
Poxvirus growth factor
Poxvirus N1L protein
Pox virus SERP1
Pox virus SERP2
Pox virus SERP3
POZ domains

pp
PP
PP1
PP3
PP4
PP5
PP10
PP11
Pp11r
PP11-related protein
PP12
PP13
PP14
PP17
pp32
pp36
pp46
pp63
pp65
pp71
pp120
pp120/HA4
PP14.1
PP14.2
pp130
pp1158
PP1201
PP3(110-135)
PP3(113-135)
pp65(340-355)
Pp-AMP 1
Pp-AMP 2
PPAR-gamma angiopoietin related
PPBP
PPBPL1
PPBSF
PPC
PP cells
PPCPSCPSCPWCPMCPRCPSCKCNPK
PPDPF
PPE18
PPEPVPPPRAAPAPTHV
PPG
PPG neurons
PPH
PPH1
PPIA
PPIA(22-39)
PPIA(23-39)
PPIA(26-39)
PPIA(63-92)
PPIA(84-100)
PPIase
PPIase A
PPIB
PPII
PPL7
PPL8
PPL13
PPLSQETFSDLWKLL
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
PPMPs
Ppn
Ppn-1
PPNOC
PPNPW
Ppo
PPOL
PPOX
PPP
PPP1R1B
PPP1R13B
PPP1R13L
PPP1R15A
PPP1R73
PPP1R172
PPPDE1
PPPVIKFNRPFLMWWIVERDTRSILFMGKIVNPKAP
PPR
PPR1
p-preDC
P-PRL
P protein
PPSCs
PPT
PPT1
PPT2
PPTA
PPTB
PPTC
PPTRH(158-183)
PPTRH(160-169)
PPTRH(178-199)
ppUL83
PPY

pQDVDHVFLRFamide
pQFDEYGHMRFamide
pQGRLGTQWAVGHLMamide
PQIMRIKPHQGQHIGE
pQIPGLGPLRG
pQLNFSTGWGGamide
pQNYLAFPRMamide
PQR
PQRFamides
PQRFa peptides
PQ-rich protein
PQRLRWamide
pQSDDYGHMRFamide
pQTSFTPRLamide
pQVTFSRDWNAamide

PR3
PR4 protein
PR-11
PR-39
PRA
Prader-Willi syndrome chromosome region
PrAg
Pramlintide
PrAMPs
PRAS40
PRASVPEGFLSELTQQL
PRBP
PRCD
PRCPPCPRCSWCPRCPTCPRCNCNPK
PrCR
PRD
PRDC
PrDGF
PRDI-BF1
PRDI-BF1-alpha
PRDI-BF1 and RIZ homologous domain
PRDI-BF1-beta
PRDI-binding factor 1
PRDM1
PRDM1-alpha
PRDM1-beta
PRDM14
PR domain
PR domain containing 1
PR domain containing 14
PR domain-containing protein 1
PR domain zinc finger protein 1
PR domain zinc finger protein 14
PRDX1
PRDX2
PRDX4
PRDX5
PRDX5(53-67)
PRDX5(205-213)
Pre-adipocyte factor-1
pre-adipocytes
Pre-adipocyte stimulating factor
Prealbumin
Pre-Alpha-Trypsin-Inhibitor
preantral granulosa cells
preapoptotic cell stress response
pre-basophil and mast cell progenitors
pre B-cell colony enhancing factor
pre B-cell colony enhancing factor-1
Pre-B-cell derived chemokine receptor
pre B-cell enhancing factor
Pre-B-cell growth factor
Pre-B-cell growth stimulating factor
pre-B-cells
pre-B-lymphocyte gene 1
pre-B-lymphocytes
pre-B lymphocyte-specific protein 2
pre-BMPs
PRECE
PRECE-1
precerebellin
pre-CFU-S
pre-Colony-forming unit spleen
precursor B-cells
precursor B-lymphocytes
precursor cells
precursor exhausted T-cells
PRED44
pre-double-positive cells
pre-DP cells
pre-ecdysis-triggering hormone
Pref-1
pregnancy-associated endometrial alpha-1-globulin
pregnancy-associated endometrial alpha-2-globulin
Pregnancy-associated glycoprotein 1
Pregnancy-associated major basic protein
pregnancy-associated plasma protein-A
pregnancy-associated plasma protein-A2
Pregnancy-associated plasma protein E
pregnancy-associated progenitor cells
pregnancy cells
pregnancy-induced growth inhibitor
Pregnancy mitogen
Pregnancy recognition hormone
pregnancy-specific b1 glycoprotein
pregnancy-specific beta-1 glycoprotein 1
pregnancy-specific beta-1 glycoprotein C/D
pregnancy-specific glycoprotein
pregnancy-specific glycoprotein 1
pregnancy-specific glycoprotein 1a
pregnancy-specific glycoprotein 1b
pregnancy-specific glycoprotein 1c
pregnancy-specific glycoprotein 1d
pregnancy-specific glycoprotein 1e
Pregnancy specific glycoprotein 16
pregnancy-specific glycoprotein 17
pregnancy-specific glycoprotein 18
Pregnancy-specific glycoprotein 23
pregnancy-specific glycoprotein 95
Pregnancy-specific glycoprotein gene A
pregnancy-specific protein B
Pregnancy Trained decidual NK-cells
Pregnancy zone protein
Pregnant cells
Pregnant mare’s serum gonadotropin
preimmunocytes
Preimplantation factor
PRELP
premitotic apoptosis
premonocytes
premotor burst neurons
pre-NK-cells
Prenyltransferase
Preosteoblast EGF-like repeat protein with MAM domain
pre-pre-B-cells
pre-pro-B-cell growth stimulating factor
pre-pro-B-cells
preprochemerin (137-156)
preprochemerin(138-157)
Preproenkephalin A
pre-progenitor cells
preproglucagon neurons
prepro-G protein-coupled receptor 8 ligand
prepro-neuropeptide W
prepronociceptin
prepro-Orexin
preproprotein
preprosomatostatin(25-34)
prepro-tachykinin
preprotachykinin-1
preprotachykinin-2
preprotachykinin-A
preprotachykinin-B
preprotachykinin-C
Preprotein
Preproteolysin
prepro-TRH
prepro-TRH(140-151)
prepro-TRH(141-149)
prepro-TRH(154-169)
prepro-TRH(158-183)
prepro-TRH(160-169)
prepro-TRH(172-199)
prepro-TRH(178-184)
prepro-TRH(178-199)
prepro-TRH(186-199)
preprothyrotropin releasing hormone
prepro-thyrotropin releasing hormone 140-151
prepro-thyrotropin releasing hormone 141-149
prepro-thyrotropin releasing hormone 154-169
prepro-thyrotropin releasing hormone 158-183
prepro-thyrotropin releasing hormone 160-169
prepro-thyrotropin releasing hormone 172-199
prepro-thyrotropin releasing hormone 178-184
prepro-thyrotropin releasing hormone 178-199
prepro-thyrotropin releasing hormone 186-199
Prepro-vasoactive intestinal peptide(81-107)
Prepro-vasoactive intestinal peptide(81-122)
preproVIP(81-107)
prepro-VIP(81-122)
Preptin
preptin(1-8)
preptin(1-16)
presenilin-2
Presenilin-associated rhomboid-like
pre-Sertoli cells
prespermatogonia
PRF
PRF1
PRG
PRG1
PRG2
PRG-2
PRG3
PRG-4
PRGB
pRGCs
PRGF
PrGF
PRH
PRI
prickle cells
primary cardiomyocyte binding peptide-1
primary cell cultures
primary cell death
primary cells
primary heart field cells
primary liver cancer
primary necrosis
primary oocytes
primary phagocytosis
primary pulmonary hypertension 1
primary response genes
primary sensory neurons
primary spermatocytes
primary trophoblast giant cells
primed cells
primed embryonic stem cells
primed pluripotent stem cells
primed stem cells
Primer recognition protein 2
priming factors
pri-miRNA
primitive hematopoietic progenitor cells
primitive hematopoietic stem cells
primitive hematopoiesis
primitive stem cell compartment
primmorphs
primordial germ cell protein 7
primordial germ cells
principal cells
principal neurons
prion protein
prion protein(23-42)
prion protein(106-126)
Privacy statement
PRK1
PRKCABP
PRKC apoptosis WT1 regulator protein
PRKCSH
PRKM1
PRKM3
PRKN
PRKRIR
PRKWNK3
PRKX
PRL
Prl1a1
Prl2a1
Prl2b1
Prl2c1
Prl2c2
Prl2c3
Prl2c4
Prl2c5
Prl3a1
Prl3c1
Prl3d1
Prl3d2
Prl3d3
Prl4a1
Prl5a1
Prl5a2
Prl6a1
Prl7a1
Prl7a2
Prl7a3
Prl7a4
Prl7b1
Prl7c1
Prl7d1
Prl8a1
Prl8a2
Prl8a3
Prl8a4
Prl8a5
Prl8a6
Prl8a7
Prl8a8
Prl8a9
PRLBP
PRL cells
PRLH
PRLHR
PRLH receptor
PRL-like protein A
PRL-like protein B
PRL-like protein C
PRL-like protein D
PRL-like protein E
PRL-like protein F
PRL-like protein G
PRL-like protein H
PRL-like protein I
PRL-like protein J
PRL-like protein K
PRL-like protein L
PRL-like protein M
PRL-like protein N
PRL-like protein O
PRL-like protein P
PRL-like proteins
PRLPA
PRLPB
PRLPC
PRLPC1
PRLPC2
PRLPC3
PRLPC4
PRLPD
PRLPE
PRLPF
PRLPG
PRLPH
PRLPI
PRLPJ
PRLPK
PRLPL
PRLPM
PRLPN
PRLPO
PRLPP
PRLR
PRLTS
PRM
PRM-151
PRMs
PRMT5
PRMTs
pRNAs
PRNP
PRNP(23-42)
Pro2-Phe3-ovokinin(2-7)
PRO34150
pro-ACTH-Endorphin
proADM[22-41]
proADM[153-185]
pro-adrenomedullin[22-41]
pro-adrenomedullin[153-185]
Proadrenomedullin N-terminal 20 peptide
Proadrenomedullin N-terminal peptide
Pro-Ala-Phe-Ser-Pro-Trp-Glyamide
proANF(1-30)
proANF(1-98)
proANF(31-67)
proANF(79-98)
pro-angiogenic microRNAs
pro-angiogenic miRs
proangiotensin-12
proANP(1-30)
proANP(1-98)
proANP(1-126)
proANP(31-67)
proANP(79-98)
Pro-apoptomiRs
proapoptosis
proapoptotic caspase adaptor protein
pro-apoptotic caspases
pro-apoptotic nucleolar protein
pro-apoptotic nucleolar protein 1
pro-apoptotic protein required for cell survival
pro-atrial natriuretic factor(1-30)
pro-atrial natriuretic factor(1-98)
pro-atrial natriuretic factor(31-67)
pro-atrial natriuretic factor(79-98)
pro-atrial natriuretic peptide(1-30)
pro-atrial natriuretic peptide(1-98)
pro-atrial natriuretic peptide(1-126)
pro-atrial natriuretic peptide(31-67)
pro-atrial natriuretic peptide(79-98)
Probable FAD-linked sulfhydryl oxidase E10
proBac5
proBac7
pro-B-cells
proBDNF
pro-B-lymphocytes
probe cells
probursin
Pro-C6
Procalcitonin
pro-casomorphins
processing bodies
procollagen 1 C-terminal peptide
Procollagenase activator
procollagen C-proteinase
Procollagen I N-proteinase
Procollagen II amino propeptide-processing enzyme
Procollagen I/II amino propeptide-processing enzyme
Procollagen II N-proteinase
Procollagen N-endopeptidase
Procollagen N-proteinase
procollagen type 2B amino-propeptide
procollagen type 2 C-propeptide
proconvertin
PROCR
Proc-R
Proct
proctolin
proctolin receptor
Pro-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Ser-Ser-Cys-Lys
procytokines
Prodepin
Prodynorphin
prodynorphin(175-179)
prodynorphin(175-183)
prodynorphin(175-184)
prodynorphin(186-204)
prodynorphin(207-211)
prodynorphin(207-214)
prodynorphin(207-219)
prodynorphin(207-223)
prodynorphin(207-238)
prodynorphin(226-230)
prodynorphin(226-238)
prodynorphin(226-254)
Prodynorphin bridge peptide
proenkephalin
proenkephalin(1-73)
Proenkephalin(114-133)
proenkephalin(119-159)
Proenkephalin(143-185)
Proenkephalin(198-207)
proenkephalin(237-258)
Proenkephalin(239-260)
proenkephalin A
proenkephalin-A(209-237)
proenkephalin-A(210-231)
Proenkephalin A(219-229)
proenkephalin-A-derived peptide (209-237)
Proenkephalin-B
proepithelin
proerythroblasts
professional antigen-presenting cells
professional phagocytes
professional phagocytic cells
professional secretory cells
Pro-FMRFamide-related neuropeptide FF
pro-gamma-MSH
progastrin-(1-35)
progastrin-(6-35)
Progastrin-(55-71)
Progastrin-(55-72)
progastrin(75-80)
progastrin(75-83)
progenipoietin
progenipoietin-1
progenipoietin-2
progenipoietin-4
progenitor B-cells
progenitor B-lymphocytes
progenitor cells
progenitor cells of the endothelium and trabeculum
progenitor endothelial cells
progenitor ionocytes
progenitors
Progenitor stimulating factor
progestagen-associated endometrial protein
progestagen-dependent endometrial protein
progesterone induced blocking factor
progesterone induced blocking factor-1
progestin and adipoQ receptor family member 1
progestin and adipoQ receptor family member 2
Progestin-dependent human endometrial protein
Pro-Glu-Asp-Gln-Glu-Leu-Glu-Ser-Leu-Ser-Ala-Ile-Glu-Ala-Glu-Leu-Glu-Lys-Val-Ala-His-Gln-Leu-Gln-Ala-Leu
proglucagon
proglucagon(1-30)
proglucagon(1-69)
proglucagon(33-69)
proglucagon(78-107)
proglucagon(126-158)
Pro-Glu-Val-Tyr-Ile-His-Pro-Phe
Pro-Gly-Ala-Ile-Pro-Gly
Pro-Gly-Ala-Val-Gly-Pro
Pro-Gly-Leu-Leu-Asp-Leu-Lys
ProGP
ProGP-1
ProGP-2
ProGP-4
programmable base editing
programmable cells of monocytic origin
Programmed cell clearance
programmed cell death
programmed cell death-1
programmed cell death-2
programmed cell death 2-like
programmed cell death-4
programmed cell death-5
programmed cell death-6
programmed cell death-7
programmed cell death-8
programmed cell death-9
programmed cell death-10
programmed cell death-11
programmed cell death-12
Programmed cell removal
programmed death-1
programmed death 1 homolog 1
programmed death-1 ligand 1
programmed death-1 ligand 2
programmed necrosis
progranulin
progranulocytes
progression associated protein
progression factors
Progressive rod-cone degeneration protein
progressor cells
Prohaptoglobin
Prohemocytes
prohormones
pro-IGF-1 E peptides
pro-IGF-2 E peptide
proIL1-alpha(81-88)
pro-inflammatory caspases
pro-inflammatory cytokines
pro-inflammatory programmed cell death
pro-inflammatory monocytes
Pro-insulin
proinsulin connecting peptide
Proinsulin C-Peptide
pro-interleukin-1-alpha(81-88)
projection neurons
PROK1
PROK2
Prokine
prokineticin-1
prokineticin-2
Prokineticin-2-beta
prokineticin Bv8
prokineticin receptor 1
prokineticin receptor 2
PROKR1
PROKR2
PROL1
Prolactin
Prolactin-3D1
prolactin-(1-148)
prolactin-binding protein
prolactin cells
prolactin family 1 subfamily A member 1
prolactin family 2 subfamily A member 1
prolactin family 2 subfamily B member 1
prolactin family 2 subfamily C member 1
prolactin family 2 subfamily C member 2
prolactin family 2 subfamily C member 3
prolactin family 2 subfamily C member 4
prolactin family 2 subfamily C member 5
prolactin family 3 subfamily A member 1
prolactin family 3 subfamily C member 1
prolactin family 3 subfamily d member 1
prolactin family 3 subfamily d member 2
prolactin family 3 subfamily d member 3
prolactin family 4 subfamily A member 1
prolactin family 5 subfamily A member 1
prolactin family 5 subfamily A member 2
prolactin family 6 subfamily A member 1
prolactin family 7 subfamily A member 1
prolactin family 7 subfamily A member 2
prolactin family 7 subfamily A member 3
prolactin family 7 subfamily A member 4
prolactin family 7 subfamily B member 1
prolactin family 7 subfamily C member 1
prolactin family 7 subfamily D member 1
prolactin family 8 subfamily A member 1
prolactin family 8 subfamily A member 2
prolactin family 8 subfamily A member 3
prolactin family 8 subfamily A member 4
prolactin family 8 subfamily A member 5
prolactin family 8 subfamily A member 6
prolactin family 8 subfamily A member 7
prolactin family 8 subfamily A member 8
prolactin family 8 subfamily A member 9
Prolactin-Inducible Protein
prolactin-like 2
Prolactin-like protein A
Prolactin-like protein B
Prolactin-like protein C
Prolactin-like protein C 1
Prolactin-like protein C 2
Prolactin-like protein C 3
Prolactin-like protein C 4
Prolactin-like protein C alpha
Prolactin-like protein C beta
Prolactin-like protein C delta
Prolactin-like protein C gamma
prolactin-like protein C-related protein
Prolactin-like protein C variant
Prolactin-like protein D
prolactin-like protein E
Prolactin-like protein F
Prolactin-like protein F alpha
Prolactin-like protein F beta
Prolactin-like protein G
Prolactin-like protein H
Prolactin-like protein I
Prolactin-like protein J
Prolactin-like protein K
Prolactin-like protein L
Prolactin-like protein M
Prolactin-like protein N
Prolactin-like protein O
Prolactin-like protein P
Prolactin-like proteins
Prolactin receptor-associated protein
prolactin-related protein-I
prolactin release-inhibiting factor
prolactin releasing factor
prolactin releasing hormone
prolactin releasing hormone receptor
prolactin releasing peptide
prolactin releasing peptide 20
prolactin releasing peptide 31
prolactin releasing peptide receptor
prolargin
Pro-Leu-Asp-Ser-Gln-Ser-Ile-Tyr-Gln-Leu-Ile-Glu-Ile
Pro-Leu-Glyamide
Proleukin
Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser
Prolevitide
Proliferation amplifying factor
proliferation and apoptosis adaptor 15
proliferation-associated gene
proliferation-associated gene A
Proliferation factor for fat-storing cells
proliferation-induced lymphocyte-associated receptor
Proliferation inducing activity
proliferation inducing gene-2
Proliferation suppressing factor
Proliferin
proliferin-1
Proliferin-2
Proliferin-3
Proliferin-4
proliferin-related protein
proline- and glutamine-rich protein
proline/arginine-rich end leucine-rich repeat protein
proline-glycine-proline
Proline racemase
Proline racemase A
Proline racemase B
proline rich 1
proline-rich Akt substrate 40 kDa
Proline-rich AKT1 substrate 1
proline-rich antimicrobial peptides
proline-rich induced protein 92
proline rich lacrimal protein 1
proline-rich motif
proline-rich peptide-1
proline-rich polypeptide
Proline-tRNA ligase
prolipoblasts
Prolixicin
prolyl 3-hydroxylase 1
prolyl hydroxylase domain-containing protein 2
prolyl-leucyl-glycinamide
prolyl-tRNA synthetase
prolymphocytes
Pro-Lys-Arg-Gly-Phe-Gln-Asp
PROM1
PROM2
promastigote surface protease
Promatrixins
pro-MCH(131-165)
promastocytes
promegakaryocytes
promegaloblasts
Promegapoietin
Promegapoietin-1
Promegapoietin-1a
pro-melanin-concentrating hormone
prominin
prominin-1
prominin-2
prominin-like-1
prominin-like-2
promininosomes
PROML1
PROML2
promonocytes
promoter-associated RNAs
promoter-associated ncRNAs
promoter-directed siRNAs
promyelocytes
pronatriodilatin
proneuropeptides
proNGF
pronormoblasts
Pro-oncosis receptor inducing membrane injury
Proopiocortin
Proopiomelanocortin
proopiomelanocortin(77-87)
proopiomelanocortin(27-102)
proopiomelanocortin(138-176)
proopiomelanocortin(156-176)
proopiomelanocortin(179-234)
proopiomelanocortin(179-267)
proopiomelanocortin(217-234)
proopiomelanocortin(237-241)
proopiomelanocortin(237-267)
proopiomelanocortin neurons
pro-PBP
Properdin
Properdin(143-161)
Properdin Factor B
properdin factor complement
Properdin factor D
Properdistatin
prophenin-1
prophenin-2
prophenin-1(62-79)
prophenins
Pro-Phe-Ser-Glu-Asp-Val-Asn-Trp-Gly-Tyr-Glu
proplasmablasts
proplasmacytes
Pro-platelet basic protein
pro-platelet basic protein-like-1
proplatelets
proprotein
Proprotein convertase 1 inhibitor
Proprotein convertase 9
Proprotein convertase subtilisin/kexin type 1 inhibitor
Proprotein convertase subtilisin/kexin type 9
Prorelaxin H1
Prorenin
Prorenin-converting enzyme
Prorenin-converting enzyme 1
prorenin receptor
Prorenin/renin receptor
prorubricytes
PROS1
ProSAAS
proSAAS-(42-59)
proSAAS-(221-242)
proSAAS-(245-260)
Prosaposin
Prosaptide D5
prosaptides
Prosaptide TX14(A)
Pro-sepiatocin
prosomatostatin(1-10)
Prospero homeobox protein 1
Prostacyclin stimulating factor
prostaglandin D2 receptor 2
prostaglandin-endoperoxide synthase 1
prostaglandin-endoperoxide synthase 2
Prostaglandin E receptor 4-associated protein
Prostaglandin F2-alpha receptor regulatory protein
prostaglandin F2 receptor negative regulator
Prostaglandin G/H synthase 2
Prostaglandin H synthase 2
Prostaglandin H2 synthase 2
prostaglandin regulatory like
prostaglandin synthase 2
Prostase
prostase/KLKL1
prostasomes
prostaspheres
prostate alpha-protein
prostate androgen-induced RNA 1
Prostate androgen-regulated mucin-like protein 1 homolog
Prostate apoptosis response genes
prostate apoptosis response protein 1
prostate apoptosis response protein 2
prostate apoptosis response protein 3
prostate apoptosis response protein 4
prostate apoptosis response protein 5
Prostate-associated gene 5 protein
Prostate-associated microseminoprotein
prostate cancer antimetastasis gene KAI1
Prostate carcinoma cell proliferation-inhibiting factor
Prostate carcinoma tumor antigen 1
prostate-derived factor
Prostate-derived growth factor
Prostate epithelial cell growth factor
prostatein
Prostate inhibin-like peptide
prostate osteoblast-like cells
prostate smooth muscle cells
prostate-specific antigen
prostate-specific membrane antigen
prostate spheres
Prostate stroma-derived factor
Prostate stroma-derived inhibiting factor
prostate stromal protein 20 kDa
prostatic acid phosphatase
prostatic acid phosphatase(248-286)
prostatic androgen repressed message-1
Prostatic cancer-derived antiproliferative activity
Prostatic growth factor
prostatic kallikrein 2
Prostatic osteoblastic factor
prostatic secretory glycoprotein
prostatic secretory glycoprotein p12
Prostatic secretory protein
prostatic secretory protein-57
Prostatic secretory protein-94
Prostatic steroid binding protein
Prostatic steroid-binding protein C1
Prostatic steroid-binding protein C2
Prostatic steroid-binding protein C3
prostatospheres
Prostatropin
Protaetin-1
Protaetin-2
Protaetin-3
Protaetins
protease-activated kringles 1-5
protease-activated receptor 1
protease-activated receptor 2
protease inhibitor 1
protease inhibitor-4
protease inhibitor-5
Protease inhibitor 10
protease inhibitor-13
protease M
Protease Nexin-1
Protease Nexin-1-alpha
Protease Nexin-1-beta
protease nexin-II
proteases
protease, serine S1 family member 22
proteasome 26S subunit2
proteasome (prosome, macropain) 26S subunit
Protectin
protection of telomeres-1
protective antigen
protector protein
Protegrin-1
Protegrin-2
Protegrin-3
Protegrin-4
Protegrins
Protein 1
Protein 7-60
protein arginine methyltransferases
protein arginine N-methyltransferase 5
Proteinase-3
Proteinase-activated receptor 1
Proteinase-activated receptor 2
proteinase inhibitor-4
proteinase inhibitor-5
proteinase inhibitor-9
Proteinase inhibitor 10
Proteinase P
proteinases
Protein C
protein C receptor
protein disulfide isomerase family A member 15
protein disulfide isomerase family A member 17
protein disulfide isomerase family A member 18
protein domains
Protein Domains Dictionary
Protein domains/sequence motifs Dictionary
protein expressed in nonmetastatic cells 6
protein expressed in nonmetastatic cells 7
protein F
protein family
Protein Functional Effector sncRNAs
Protein Fv
Protein HC
protein I/II
protein inhibitor of activated STAT
protein inhibitor of activated STAT1
protein inhibitor of activated STAT2
protein inhibitor of activated STAT3
protein inhibitor of activated STAT4
protein inhibitor of activated STAT-gamma
protein interacting with carboxyl terminus 1
protein interacting with C kinase 1
protein kinase C-alpha binding protein
protein kinase C-associated kinase
Protein kinase C conserved region 1
Protein kinase C conserved region 2
Protein kinase C inhibitor protein-1
protein kinase C substrate 80K-H
protein kinase C substrate RC3
protein kinase domain containing, cytoplasmic
protein kinase lysine deficient 3
protein kinase, mitogen-activated 1
protein kinase, mitogen-activated 3
Protein kinase with no lysine 3
Protein kinase X
protein kinase, X-linked
protein kinase, X-linked 1
protein lysine methyltransferases
protein migrating faster than albumin
protein P1
protein phosphatase 1 regulatory subunit 1B
protein phosphatase 1 regulatory subunit 13B
Protein phosphatase 1 regulatory subunit 15A
protein phosphatase 1 regulatory subunit 73
protein phosphatase 1 regulatory subunit 172
protein phosphatase 1 regulatory subunit 13 like
protein-protein interaction motif
protein related to DAN and cerberus
Protein S
protein S-alpha
protein S-beta
protein transduction
protein transduction domain-3
protein transduction domain-4
protein transduction domain-5
protein transduction domains
Protein tyrosine kinase
protein tyrosine kinase 3
protein tyrosine phosphatase-eta
protein-tyrosine phosphatase nonreceptor-type 10
protein tyrosine phosphatase nonreceptor type substrate 1
protein tyrosine phosphatase receptor type C
protein tyrosine phosphatase receptor type Ca
protein tyrosine phosphatase receptor type Cb
Protein tyrosine phosphatase receptor type J
protein tyrosine phosphatase receptor type zeta-1
protein tyrosine phosphatase receptor-zeta
protein tyrosine phosphatase-zeta
protein upregulated in macrophages by IFN-gamma
Protein with TSP type-1 repeat
Protein X
Protein-X
protein Z-dependent protease inhibitor
proteloblasts
Proteoglycan-1
proteoglycan-2
Proteoglycan-4
proteoglycan 40 kDa
proteoglycanase
proteoglycan M-CSF
Proteoglycans
proteoglycan S2
Proteolysis inducing factor
Proteose-peptone component 3
Proteose-peptone component 3(110-135)
Proteose-peptone component 3(113-135)
prothoracicostatic peptides
Prothoracicotropic hormone
Prothrombase
prothrombin
Prothrombinase
Prothrombin accelerator
Prothrombin kringle-2 domain
Prothymocyte Differentiating Activity
Prothymosin
Prothymosin-alpha
Prothymosin-alpha(1-28)
prothymosin-alpha(49-78)
prothymosin-alpha(51-56)
Prothymosin-alpha(52-60)
prothymosin-alpha(100-109)
prothymosin-alpha P6 peptide
prothymosin-alpha P6Q peptide
Prothymosin-alpha P9 peptide
Prothymosin-alpha P30 peptide
Prothyroliberin
Prothyroliberin(140-151)
Prothyroliberin(178-199)
Protirelin
protocerebral bridge-ellipsoid body noduli neurons
Protonectin
Protonectin (1-6)
Proto-oncogene
proto-oncogene CPH
protoplasmic astrocytes
Protoplasmic enteric gliocytes
pro-TRH-connecting peptides
Protropin
Pro-Trp-Cys-Tyr-Val-Gln-Val-Gly-Leu-Lys-Pro-Leu-Val-Gln-Glu
Pro-Tyr-Val-Arg-Tyr-Leu
Pro-Val-Asn-Phe-Lys-Leu-Leu-Ser-His
Pro-Val-Asn-Phe-Lys-Phe-Leu-Ser-His
Proviral Integration of Moloney virus
Proviral Integration of Moloney virus 1
Proviral Integration of Moloney virus 2
Proviral Integration of Moloney virus 3
Prower-Stuart factor
PROX1
Proxenin
Proximal symphalangism 1A
PRP
PRP1
PRP-1
PRP 2
PrRP20
PrRP31
PRP43
PrP(106-126)
PrPc
PR peptide
PRPS
PRPSPKMGVSVS
PRR
PRR1
PRR2
PRR2-alpha
PRR2-delta
PRR3
PrRP
PRRPR
PRRs
PRSS9
PRSS11
PRSS17
PRSS18
PRSS19
PRSS22
PRSS25
Prss26
PRTN3
PrtS
PRV1
PRVamides
PRX1
PRX2
PRX4
PRX5
PRY domains
PRY-SPRY/B30.2 domains
PRYSPRY domains

ps
PS
pS2
PS4
Ps4
Ps5
PS18
ps20 growth inhibitor
PS3-10
PS-341
PSA
psacotheasin
PS-alpha
PSA-NCAM
PSAP
PSB
PS-beta
PSBG1
PSBP
Psbpc1
Psbpc2
Psbpc3
PSCs
PSC cells
pSE(14)
PSEL
P-selectin
P-selectin glycoprotein ligand
P-selectin glycoprotein ligand-1
Pseudaletia pheromonotropin
Pseudaletia separata growth-blocking peptide
Pseudhymenochirin-1Pb
Pseudin-1
Pseudin-2
Pseudin-3
Pseudin-4
Pseudins
pseudoautosomal boundary region, X-linked
Pseudobistratfied amacrine cells
Pseudocowpox virus VEGF
pseudo-Gaucher cells
Pseudogene RNAs
pseudogenes
Pseudo-ICE
Pseudo-IL1-beta-ICE
Pseudo-interleukin-1-beta converting enzyme
pseudo-mature NK-cells
Pseudomonas aeruginosa exotoxin A
Pseudomonas Endotoxins
pseudo-Pelger-Huët cells
pseudopodocytes
pseudopodial protrusions
pseudopod translocation
pseudo-pseudo-Gaucher cells
pseudorabies virus glycoprotein G
pseudorabies virus growth factor
pseudorabies virus gII glycoprotein
pseudorabies virus US3 kinase
pseudostratified amacrine cells
pseudo-vasculogenesis
PSF
PSFHSWSamide
PSG
PSG1
PSG1a
PSG1b
PSG1c
PSG1d
PSG1e
PSG16
PSG17
PSG18
PSG23
PSG95
PsGBP
PSGGA
PSGL
PSGL-1
PSH
psh
PsHCt1
PsHCt2
PSHISKYILRWRPK
PSI
Psidin
PSIP1
PSIP2
Psi-Xenin-6
PSLF
PSM
PSMA
PSM-alpha
PSM-alpha-1
PSM-alpha-2
PSM-alpha-3
PSM-alpha-4
PSM-beta
PSM-beta-1
PSM-beta-2
PSM-beta-3
PSMC
PSMD2
PSMD4
PSM-gamma
PSM-mec
PSMP
PSMs
PS-OFF cells
PS-OFF neurons
PS-ON cells
PS-ON neurons
PSOR1
PSORS12
Psoriasin
psoriasin 1
psoriasis susceptibility 12
Psoriatic leukotactic factor
PSP
PSP1
PSP-1
PSP57
PS-p68
PSP94
PSP94-binding protein
PSP(141-153)
PSP94(31-45)
PSPa
PSPb
PSPB
PSPBP
PSPN
PSPS
PSS
PsT-1
PST
PSTHVLITHTI
PSTI
PSTI-1
PSTI-2
PSTI-3
PSTI-56
PSTI-61
PSTS
PSVQGAAAQLTADVKK
Psychoneuroimmunology
psychosine receptor

p-T
PT-1
Pt5 peptide
Pt5e peptide
PT-18
pT49
PTA1
PTAG
PtALF
p-TB
PTB domain
PTB domain-containing engulfment adapter protein 1
PTC
ptc
PTC1
PTC2
PTCH
PTCH1
PTCH2
PTdNKs
PTDs
PTD-3
PTD-4
PTD-5
PTDA
PtdSer
P teloblasts
Pterin-4-alpha-carbinolamine dehydratase
Pterin-4-alpha-carbinolamine dehydratase/Dimerization cofactor of HNF1
Pterin carbinolamine dehydratase
Pteroylpoly-gamma-glutamate carboxypeptidase
pteroylpolyglutamate hydrolase
PtesALF
PtesALF1
PtesALF2
PtesALF3
PTF
PTF-alpha-1
PTG-1
PTG-2
PTG-3
PTG-4
PTGDR2
PTGF-beta
PTGFRN
PTGS
PTGS1
PTGS2
PTH
PTH1
PTH1R
PTH2
PTH2R
PTH2 receptor
Pth4
PTH(1-31)amide
PTH1-31C
PTH(1-34)
PTHLH
PTH-PTHrP receptor
PTHR
PTHR1
PTHR2
PTH-related peptide
PTH-related protein
pTreg
PTRH2
PTHrP
PTHrP[1-36]
PTHrP[1-40]
PTHrP(12-48)
PTHrP[38-94]
PTHrP[107-111]
PTHrP[107-139]
PTKs
PTK3
PTMA
PTMB4
PTMB10
PTMS
PTN
PTP
PTP1C
PTPN6
PTPN10
PTPNS1
PTPRC
PTPRCa
PTPRCb
PTPRJ
PTPRZ
PTPRZ1
PTPZ
PTP-ZETA
PTTG1 interacting protein
PTTG1IP
PTTG-binding factor
PTTH
PTX
PTX1
PTX2
PTX3
PTX3(100-104)
PTXF
P-type atypical lymphocytes
P-type lectins

pu
PU.1 interaction partner
PU-34
pudgy
PuF
pUL36
pUL38
pUL83
pUL21.5
Pulmonary and activation-regulated chemokine
pulmonary artery endothelial cell-derived survival factor
pulmonary artery endothelial cells
pulmonary artery smooth muscle cells
pulmonary ionocytes
pulmonary neuroepithelial bodies
Pulmonary P cells
pulmonary type 1 cells
pulmonary type 2 cells
pulmonary venous smooth muscle cells
pulmospheres
PUM
PUMA
PUMA-alpha
PUMA-beta
PUMA-G
PUMP
pump-1
pump neurons
Punctin
Punctin-1
Punctin-2
punctuated metalloproteinase
punt
purified synovial lubricating factor
purinergic neurons
Purkinje cell degeneration
Purkinje cells
Purkinje-cell survival factor
Purkinje fibers
Purkinje neurons
Puroindoline A
Puroindoline B
Puroindolines
puromycin-insensitive leucyl-specific aminopeptidase
Purpurin
pursuit neurons
put
PUT1
putative DNA/chromatin-binding motif 1
putative HLA class II-associated protein 1
putative metalloproteinase-1
Putative secreted protein 9

PV cells
PvD1
pVEC
pVEC(615-632)
Pvf1
Pvf2
Pvf3
PvHCt
PVK
PVK-1
PVK-2
PVKVYPNGAEDESAEAFPLEF
PVL
PVM/Ms
PV neurons
PVNFKFLSH
PVNFKLLSH
PVNSGRSSGSRFNFGLamide
PVNZ112.0-CBP
PVNZ112.3-CBP
PVNZ112.6-CBP
Pvr
PVR
PVR-alpha
PVR-beta
PVR-delta
PVR-gamma
PVRL1
PVRL2
PVRL3
PVRR
PVRR1
PVRR3
PVRRPRRRRRRK
PVS
PVSKMRMATPLLMQA
PVSMC

Pw1
PWCR
PWCYVQVGLKPLVQE
pwe
PWNIFKEIERAVARTRDAVISAGPAVRTVAAATSVAS
PWTSR
PWWP domain

px
PXA domain
PXDN
PX domain
PX domain associated domain
PXe domain
PXN

PY
PYCARD
PYCS
PYD
PYDC1
PYDC2
PYGGYGWamide
pygmy
PYHIN1
PYHIN2
PYHIN3
PYHIN4
PYHIN family
PYK2 N-terminal domain-interacting receptor 1
pyknosis
PYNOD
PYP
PYPAF1
PYPAF2
PYPAF3
PYPAF4
PYPAF5
PYPAF6
PYPAF7
PYPAF8
pYR
Pyr(1)apelin-13
pyramidal cells
pyramidal neurons
pyramus
pyrenocytes
Pyr-Gln-Asp-Tyr-Thr-Gly-Trp-Met-Asp-Pheamide
Pyrimidine phosphorylase
Pyrin
Pyrin and HIN domain-containing protein 1
Pyrin and HIN domain-containing protein 2
Pyrin and HIN domain-containing protein 3
Pyrin and HIN domain-containing protein 4
pyrin and HIN domain-containing protein family
pyrin and HIN domain family member 1
pyrin and HIN domain family member 2
pyrin and HIN domain family member 3
pyrin and HIN domain family member 4
Pyrin-containing APAF-1-like protein 1
Pyrin-containing APAF-1-like protein 2
Pyrin-containing APAF-1-like protein 3
Pyrin-containing APAF-1-like protein 4
Pyrin-containing APAF-1-like protein 5
Pyrin-containing APAF-1-like protein 6
Pyrin-containing APAF-1-like protein 7
Pyrin-containing APAF-1-like protein 8
Pyrin domain
pyrin domain and nucleotide-binding oligomerization domain containing protein
pyrin domain-containing 1
pyrin domain-containing 2
pyrin inflammasome
pyrin-only protein 1
pyrin-only protein 2
pyroEGVNDNEEGFFSAR
pyroELYAFPRVamide
pyrogenic exotoxin B
pyrogens
PyroGlu-Glu-Asp-Cys-Lys
pyroGlu-Glu-Asp-Ser-Gly
pyroGlu-serpinin
pyroglutamate aminopeptidase 2
pyroglutamylated arginine-phenylalanineamide peptide
pyroglutamylated RFamide peptide
Pyroglutamyl peptidase II
Pyrokinin-1
Pyrokinin-2
Pyrokinin-2 receptor 1
Pyrokinin-2 receptor 2
pyrokinin/PBAN family
Pyrokinins
Pyronecrosis
pyroptosis
pyroptosome
Pyrrhocoricin
pyrroline-5-carboxylate synthetase
pyruvate kinase
pyruvate kinase 2
pyruvate kinase 3
pyruvate kinase(2-18)
pyruvate kinase 3(2-18)
pyruvate kinase M2
pyruvate kinase M2(2-18)
pyruvate kinase muscle
pyruvate kinase muscle 2
pyruvate kinase muscle(2-18)
pyruvate kinase muscle 2(2-18)
PYVALFEKCCLIGCTKRSLAKYC
PYVRYL
PYY
PYY(1-36)
PYY(3-36)
PYY-I
PYY-II

PZ-dependent protease inhibitor
PZP
Pz-peptidase



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.