Pattern recognition receptor Dictionary |
paucity of lymph node T-cells |
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
||
[pattern recognition receptor]
See: PAMPs [pathogen-associated molecular patterns]. See also: Pattern recognition receptor MiniCOPE Dictionary, which collects entries pertaining to proteins that have functions as pattern recognition receptors or pathogen pattern receptors.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |