PMAP-23 |
p-MB |
longjohn |
||
[porcine myeloid antimicrobial peptide-36] PMAP-36 (VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG) has been identified by Storici et al (1994) as a cDNA cloned from pig bone marrow RNA. The encoded peptide belongs to the family of cathelicidins and shows a broad spectrum antimicrobial activity against both Gram-negative bacteria and Gram-positive organisms, and is not active against eukaryotic cells. As shown for Escherichia coli, the activity of this peptide appears to be mediated by its ability to permeabilize the bacterial membranes.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |