proBac7 |
proBDNF |
QGVRSYLSCWGNRGICLLNRCPGRMRQIGTCLAPRVKCCR |
||
[pro-B-cell]
also: pro-B-lymphocytes. Pro-B-cells, defined as CD19(+) CD34(+) CD10(+) IgM(-), are an early identifiable intermediate cell type in a series of developmental stages eventually leading to the generation of mature B-cells. Pro-B-cells develop from hematopoietic stem cells derived from fetal liver (Hardy and Hayakawa, 2001; Osmond, 1990). Pro-B-cells further develop into pre-B-cells, defined as CD19(+) CD34(-) CD10(+) IgM(-), following induction of recombination-activating genes RAG1 and RAG2 and production of the heavy chain immunoglobulin (Ig) (Schatz and Baltimore, 2004). These cells then then yield cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |