PGP |
PGP1.1 |
KSCCRSTTARNIYNGCRVPGTARPVCAKKSGCKIQEAKKCEPPYD |
||
[PGP1(+), PGP1(-)]
[phagocytic glycoprotein-1] The gene encoding this murine T-cell and leukocyte differentiation antigen (95 kDa glycoprotein) has been cloned by Zhou et al (1989) and Nottenburg et al (1989). An allelic form is PGP1.1, and this is the form cloned by Zhou et al (1989) as the mouse homolog of human HCAM [homing-associated cell adhesion molecule].
PGP1 is present at high levels on 80 to 90% of fetal thymocytes (Lesley et al, 1985) and on a subset of young adult thymocytes (Budd et al, 1987). The protein is known mostly as a T-cell
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |