Pyrimidine phosphorylase |
Pyrin and HIN domain-containing protein 1 |
AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR |
||
This protein of 781 amino acids has been described first as the gene product of a candidate gene, designated MEFV, for familial Mediterranean fever under the name Marenostrin. Familial Mediterranenan fever is an autosomal recessive disease characterized by recurrent attacks of fever with synovial, pleural or peritoneal inflammation. The protein is being referred to also as FMF protein [Familial Mediterranenan fever protein]. The protein is being referred to also as TRIM20 [tripartite motif-containing protein 20], a term that refers to the multidomain structure found in members of the family of TRIM proteins (tripartite motif) (James et al, 2007)
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |