pleckstrin homology-like domain family A member 2 |
Pleiotrophic factor-alpha-1 |
carcinoma-derived growth factor |
||
Plectasin (GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY) has been isolated from the saprophytic ascomycete Pseudoplectania nigrella (Mygind et al, 2005). Plectasin has primary, secondary and tertiary structures that closely resemble those of defensins found in spiders, scorpions, dragonflies, and mussels. In vitro, Plectasin is especially active against Streptococcus pneumoniae, including strains resistant to conventional antibiotics. Plectasin shows extremely low toxicity in mice, and cures them of experimental peritonitis and pneumonia caused by Streptococcus pneumoniae as efficaciously as vancomycin and penicillin.
Hara et al (2008) have reported that plectasin has specific antibacterial activity against Streptococcus pneumoniae, shows no cytotoxicity to A549 cells, normal human bronchial epithelial cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |