p-T |
Pt5 peptide |
TotB |
||
[potamin-1] PT-1 is a 5.6 kDa trypsin-chymotrypsin protease inhibitor isolated from the tubers of the potato (Solanum tuberosum L cv. Gogu) (Kim et al, 2005). PT-1 (DICTNCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA) possesses antimicrobial activity but lacks hemolytic activity. PT-1 strongly inhibits pathogenic microbial strains, including Candida albicans, Rhizoctonia solani, and Clavibacter michiganense subsp. michiganinse. The N-terminal sequence of PT-1 has 62 % homology with a serine protease inhibitor belonging to the Kunitz family, and the peptide inhibits chymotrypsin, trypsin, and papain.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |