pH 34 |
PHACTR1 |
RNCMEVCVKGEKKHTGQGMIRRLRRNKNNSIFVVRKRV |
||
This antigen is detected by rat monoclonal antibody ph91 that has been generated by Pezzano et al (1998) against a thymic epithelial cell line. The antibody recognizes an as yet unidentified 43 kDa protein specifically on the cell surface of thymic nurse cells in the thymus. The antigen is expressed already quite early during development and is expressed by thymic epithelial progenitor cells (Hendrix et al, 2010; Chilukuri et al, 2014).
The pH91 antigen participates in the internalization of immature thymocytes at the triple positive stage of development and is vital for the survival of the developing thymus (Pezzano et al, 1998).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |