PE-11 |
PEA15B |
TAMRAVDKLLLHLKKLFREGQFNRNFESIIICRDRT |
||
[phosphoprotein enriched in astrocytes 15] PEA15 is the approved gene symbol and the long form is proliferation and apoptosis adaptor 15. PEA15 has been described independently as PED [phosphoprotein enriched in diabetes], and MAT1 [mammary transforming gene 1] (variously found in databanks as HMAT1, HUMMAT1H, and MAT1H [homolog of mouse MAT-1 oncogene]).
This protein of 15 kDa is the major phosphoprotein in astrocytes
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |