Peyer's patch M cells |
PF-1 |
GLWESIKNLGKKFALNIMEKLKCKFGGGCLP |
||
[Placental factor] A 40 kDa concanavalin A-binding glycoprotein extracted from mouse placenta (Bleux et al, 1995; Bobé et al, 1994). PF strongly inhibits secondary antibody responses and cellular responses. The factor does not appear to be identical with TGF-beta or IL10.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |