peptide-linked phosphorodiamidate Morpholino oligomers |
peptide mimetics |
Transcribed ultraconserved regions |
||
Peptide Lv has been identified through a bioinformatic strategy designed to scan cDNA sequences for novel peptides. Peptide Lv (DNLLAVRWFFAHSFDSQEALMVKMTKLRVVQYYGNFSRSA) is named after its ability to enhance L-type voltage-gated calcium channel (L-VGCC) currents in cone photoreceptors. Exogenous peptide Lv stimulates cAMP production, enhances phosphorylation of extracellular signal-regulated kinase (ERK), and increases the expression of L-VGCC-alpha-1 subunits in cone photoreceptors.
Although this has not been reported by the authors, a blast search of the reported sequence shows 98 % homology with human VSTM4 [V-set and transmembrane domain-containing protein 4] encoded by
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |