Cope Home	Previous entry: PRL cells	Next entry: PRLHR	Random entry: Stromal interaction molecule 2
Search COPE:

PRLH

(approved gene symbol) [prolactin releasing hormone]. Abbr. also: PRH; Also: PrRP [prolactin releasing peptide]. Also: prolactin releasing factor (note that this term may be used generically also for any factor causing the release of prolactin from producer cells).

PRLH has been identified by Hinuma et al (1998) as the ligand of an orphan receptor (subsequently designated PRLHR, see below). PRLH is a ligand of 31 amino acids [SRTHRHSMEIRTPDINPAWYASRGIRPVGRF]. PRLH exists in two isoforms, usually termed PrRP31 [prolactin releasing peptide 31 ... ... ... ... ... Subscribe to continue reading! ... ...

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.
Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links
with a 15 USD/month subscription at Cells-Talk.com
See example pages at the bottom of the Cells-Talk.com home page THE SMART ONES COPE
The others just sisyphos around

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: June 2013

SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials

# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts
About the author of COPE   |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=41573