Ponericin-L2 |
Ponericin W |
Measles virus P protein |
||
Ponericins constitute a family of at least 15 antimicrobial, insecticidal, and hemolytic peptides isolated from the venom of the predatory ant Pachycondyla goeldii, a member of the subfamily Ponerinae (Orivel et al, 2001). Members of the three subfamilies, designated ponericin G (related to members of the cecropin family), ponericin W (related to members of the gaegurin family and melittin), and ponericin L (related to dermaseptins and some oxyopinins), share structural similarities.
Ponericin-G1 [GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ]
Ponericin-G2 [GWKDWLKKGKEWLKAKGPGIVKAALQAATQ]
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |