COPE Media Kit


Cope Home
Previous entry:
PGTCEICAYAACTGC
Next entry:
pH2-labile interferon
Random entry:
MLWSASMRIFASAFSTRGLGTRMLMYCSLPSRCWRK
Search COPE:

PGY1

This is a databank synonym for P-glycoprotein (the same as P-glycoprotein-1), which is known also as MDR-1.

In the nomenclature of CD antigens this protein has been given the designation CD243.

For additional information on CD antigens see also: CD antigens Dictionary.

... ... ... ...
 
... CONTINUE READING at cells-talk.com, COPE's new home with 61 100+ entries, 141 552 cited references and >2,5 million internal hyperlinks. This most comprehensive knowledge base provides extensive in-context information covering nomenclature, terminology, and highlighting concepts, strategies & complexities of cellular communication processes. COPE's fully integrated subdictionaries include Dictionary of Angiogenesis • Dictionary of Antimicrobial & host defense peptides • Dictionary of Apoptosis and cell death • Dictionary of CD antigens • Dictionary of Chemokines • Dictionary of Cryptides • Dictionary of Cytokines & Growth factors • Dictionary of Eukaryotic cell types & expression profiles • Dictionary of Hematopoiesis • Dictionary of Hormones • Dictionary of Inflamation & inflammatory mediators • Dictionary of Innate Immunity • Dictionary of Metalloproteinases • Dictionary of Moonlighting proteins & cryptides • Dictionary of Neuropeptides • Dictionary of Pathogenicity & Virulence Factors • Dictionary of Pattern recognition receptors • Dictionary of Protein domains • Dictionary of Regulatory peptide factors • Dictionary of Viroceptors • Dictionary of Virokines • Dictionary of Stem cells and more.
 
An important note about your privacy: A search engine may have brought you here. If the provided URL differs in any way from "www.copewithcytokines.org/cope.cgi?key=search term", 3rd parties may record your activities on COPE. Bypass snoopers by doing this: Go directly to cells-talk.com or go to copewithcytokines.org in a new browser tab and from there explore whether COPE contains the terms that interest you. The private bioinformatics initiative COPE at cells-talk.com never shares your search histories or user databank entry with 3rd parties.

Copyright © 1997-2025. All rights reserved by Dr H Ibelgaufts, the sole author/owner/maintainer of the COPE Knowledge Base. EXPLICITLY: COPE's contents are strictly for the personal use of subscribers. They aren't in the public-domain and may not be reproduced elsewhere or transmitted in any form!

Entry completed



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.040001. key=44418