Pandinin-2 |
panepithelial glycoprotein 314 |
ETHR-A |
||
Pandinins are antimicrobial peptides from Pandinus imperator (Emperor scorpion) (Corzo et al, 2001).
Pandinin-1 (databank synonym NDBP-3.4 [Non-disulfide-bridged peptide 3.4]) has the sequence (GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT). Pandinin-1 consists of two distinct alpha-helices separated by a coil region of higher flexibility.
Pandinin-2 (databank synonym NDBP-4.1 [Non-disulfide-bridged peptide 4.1]) has the sequence FWGALAKGALKLIPSLFSSFSKKD. Pandinin-2 is composed of a single alpha-helix.
Both
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |