COPE Advertising options



Previous Next
Search COPE:
 


- E -

Select one of the following:


e

E1B 19 kDa protein
E1B-55K

E2 protein
E2 antigen
E2a-Pbx1 target gene in fibroblasts 5
E2a-Pbx1 target gene in fibroblasts 10
E2IG3
E2IG4
E2IG5
E2-induced gene 3
E2-induced gene 4
E2-induced gene 5

E3L-like protein
E3L protein
E3 protein
E3 SUMO-protein ligase PIAS1
E3 SUMO-protein ligase PIAS2
E3 SUMO-protein ligase PIAS3
E3 SUMO-protein ligase PIAS4
E3 ubiquitin/ISG15 ligase
E3 ubiquitin ligase gp78
E3 ubiquitin-protein ligase MARCH7

E4orf4

E5NT
E-5'Nu
E5 protein

E6 protein

E7 protein

E8

E9 protein

E10
E10R
E1.1
E11 antigen
E13
E14S
E16
E19
E19S

E21 antigen
E21R
E29

E48

E123
E163

E3 19 kDa protein
E3-6.7
E3-10.4
E3-11.6K
E3-14.5
E3-14.7K

EA
Ea
EA1
EA-92
Ea3.17
EAAC1
EAAC2
EAAT3
E-ADA
eae
EAEC
EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ
EAF
EAFSPWAamide
EAKSQGGSD
EAKSQGGSN
EALELARGAIFQA
EAMNSAEQSAAVVQWEKRRI
EAP
EAP1
EAP2
EAPF
EAPI
EAQQHMLQLTVWGIKQLQAR
EAR
EAR-1
early antigen 1
early apoptotic cells
early endothelial precursor cells
Early endothelial progenitor cells
early erythroblasts
early genes
early growth response alpha
Early growth response gene-1
Early growth response gene-2
Early growth response gene-3
Early growth response gene-4
Early growth response genes
Early hematopoietic zinc finger protein
early lymphoid progenitor
early placenta insulin-like peptide
Early placenta insulin-like peptide A chain
Early placenta insulin-like peptide B chain
early population doubling level cDNA
Early pregnancy factor
early Pro-B-cells
early progenitor with lymphoid and myeloid potential
early quiescence protein-1
Early response genes
Early-stage apoptotic cells
early T-cell activation antigen p60
early T-cell progenitors
early thymic progenitors
early thymocyte progenitors
early T-lymphocyte activation protein 1
early TPA responsive 101
early TPA responsive 103
EARPALLTSRLRFIPK
Ear sponge assay
EASF
EASPRVSRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG
EAST
Easter
East Lansing Tyrosine Kinase
Eater
eat-me signals

EB1
EB6
EB6ACTI
EB9
EBAF
EBAG9
EBD
EBD cells
EBER-associated protein
EBI-1
EBI-1-Ligand Chemokine
EBI-3
EBI-6
EBM11
EBNA-5
EBNA-LP
ebnerin
Ebola viral protein 24
Ebola viral protein 35
Ebola Virus Delta Peptide
EBP
EBP-37
EBP67
EB-PE
EBSA
EBV BNLF1
EBV BNLF2a
EBV BPLF1
EBV BZLF1
EBV BZLF2
EBV cell surface antigen
EBVCS
EBVCS1
EBVCS2
EBVCS3
EBVCS4
EBVCS5
EBV dUTPase
EBV gp42 protein
EBV IL10
EBV induced gene-1
EBV induced gene-3
EBV induced gene-6
EBV receptor

EC
EC1 cells
EC2 cells
EC50
EC1.4.4.2
EC1.6.3.5
EC1.6.4.5
EC1.6.5.2
EC1.8.1.4
EC1.8.1.9
EC1.8.3.2
EC2.3.2.2
EC2.4.2.4
EC2.5.1.1
EC2.7.2.3
EC2.7.4.6
EC3.1.3.2
EC3.1.3.4
EC3.1.3.5
EC3.1.4.3
EC3.2.2.5
EC3.3.2.6
EC3.5.3.1
EC3.5.4.4
EC3.6.1.5
EC3.6.3.9
EC4.2.1.3
EC4.6.1.2
EC5.3.1.1
EC5.3.1.9
EC5.3.2.1
EC6.1.1.1
EC6.1.1.2
EC6.1.1.3
EC6.1.1.5
EC6.1.1.6
EC6.1.1.7
EC6.2.1.4
EC6.3.4.5
EC1.11.1.6
EC1.1.1.27
EC1.1.1.37
EC1.15.1.1
EC1.16.3.1
EC1.2.1.12
EC1.2.1.27
EC1.6.99.2
EC2.1.1.45
EC2.3.1.16
EC2.3.1.85
EC2.4.2.12
EC2.4.2.30
EC2.4.2.31
EC2.5.1.10
EC2.7.1.20
EC2.7.1.36
EC2.7.1.40
EC2.7.7.49
EC2.7.7.86
EC3.1.1.13
EC3.1.1.17
EC3.1.22.1
EC3.1.3.48
EC3.2.1.17
EC3.2.1.23
EC3.4.11.2
EC3.4.11.3
EC3.4.11.7
EC3.4.14.5
EC3.4.15.1
EC3.4.19.6
EC3.4.21.6
EC3.4.23.7
EC3.4.4.15
EC3.5.1.28
EC3.6.1.23
EC3.6.1.3.5
EC4.1.1.84
EC4.1.2.13
EC4.2.1.11
EC6.1.1.10
EC6.1.1.11
EC6.1.1.14
EC6.1.1.15
EC6.1.1.18
EC6.1.1.20
EC6.1.1.21
EC6.1.1.22
EC1.1.1.205
EC2.1.1.320
EC2.4.1.228
EC2.4.99.18
EC3.4.11.18
EC3.4.12.10
EC3.4.17.10
EC3.4.17.23
EC3.4.21.39
EC3.4.21.59
EC3.4.21.34
EC3.4.21.35
EC3.4.21.38
EC3.4.21.47
EC3.4.21.76
EC3.4.22.11
EC3.4.22.27
EC3.4.23.15
EC3.4.24.11
EC3.4.24.14
EC3.4.24.15
EC3.4.24.16
EC3.4.24.17
EC3.4.24.18
EC3.4.24.19
EC3.4.24.22
EC3.4.24.23
EC3.4.24.24
EC3.4.24.35
EC3.4.24.36
EC3.4.24.56
EC3.4.24.61
EC3.4.24.63
EC3.4.24.65
EC3.4.24.79
EC3.4.24.81
EC3.4.99.19
EC4.2.1.109
EC4.2.99.18
EC3.4.21.118
EC3.4.21.119
ECA
ECAD
E-cadherin
Ecalectin
ECAT2
ECAT3
ECAT4
ECAT5
ECAT8
ECAT9
ECAT11
ECAT15-1
ECAT15-2
eCATH-1
eCATH-2
eCATH-3
Ecb
EC cells
EC collagen
EC-derived contra-IL1
ECDGF
Ecdysis activator
ecdysis triggering hormone
ecdysis triggering hormone 1
ecdysis triggering hormone 2
Ecdysone-inducible gene L2
ECE
ECE-1
ECEF
E cells
E-cells
EC-ETAF
ECF
ECF-A
ECFCs
ECF-L
ECF-PI5
ECF-PI6
ECF-PI7
ECF-PI8
ECF-PI9
ECFSTA
eCG
ECGF
ECGF-alpha
ECGF-beta
ECGF-1
ECGF-2a
ECGF-2b
EC-GRAM
ECGS
echidna hedgehog
Echinococcus granulosus tegumental protein
echinocytes
echinocytic erythrocytes
Echinometrin
Echinotocin
Echis carinatus sochureki Cysteine-rich secretory protein
ECI
ECIF
ECIF releasing factor
ECIF-RF
EC IL3
Ecilin
ECIP-1
ecircRNAs
eCIRP
ECIS/taxis
ECK
ECKR
ECL cells
ECLF3
eclosion hormone
ECM
ECM1
ECM1a
ECM1b
ECM1c
ECM2
ECMR-1
ECMR-2
ECMR-3
ECMR-6
Ecogenin
E. coli-secreted protein F
E. coli-secreted protein J
ECop
ecotropic viral integration site 2B
ecotropic viral integration site 9
ecotropic viral integration site 27
ECP
ECP-1
ECP-2
ECP(1-45)
ECP(8-36)
ECP(32-41)
ECRF-3
ECRG4
ECRG4(31-70)
ECRG4(31-148)
ECRG4(71-132)
ECRG4(71-148)
ECRG4(133-148)
ECRG4-derived 16 peptide
ECSA
ECSCR
E-CSF
ECSF
ECSM2
ECSM3
EC-SP cells
Ecto-ADA
ecto-Adenosine deaminase
Ecto-ADPase
Ecto-ADP-ribosyltransferase 4
Ecto-Apyrase
Ecto-ATPase
ecto-ATPSB
ecto-ATPS-beta
ecto-ATP Synthase
ecto-ATP Synthase-beta
ecto-Calreticulin
ecto-CRT
ecto-Cytochrome C
ectoderm
ectodermal dysplasia 4
Ectodin
ectodomain shedding
Ectodysplasin
Ectodysplasin-1
ectodysplasin A
ectodysplasin A1
ectodysplasin A1 receptor
ectodysplasin A2
ectodysplasin A2 receptor
ectodysplasin A receptor
Ectodysplasin-A receptor-associated adapter protein
ecto-F1-ATPase
ecto-NAD+ glycohydrolase
Ecto-nicotinamide adenine dinucleotide glycohydrolase
ectonucleoside triphosphate diphosphohydrolase 1
ectonucleoside triphosphate diphosphohydrolase 2
ectonucleoside triphosphate diphosphohydrolase 3
ectonucleoside triphosphate diphosphohydrolase 5
ectonucleoside triphosphate diphosphohydrolase 6
ecto-5'-nucleotidase
ectonucleotide pyrophosphatase/phosphatase 1
ectonucleotide pyrophosphatase/phosphatase 2
ectonucleotide pyrophosphatase/phosphatase 3
ectonucleotide pyrophosphatase/phosphodiesterase 1
ectonucleotide pyrophosphatase/phosphodiesterase 2
ectonucleotide pyrophosphatase/phosphodiesterase 3
ectonucleotide pyrophosphatase/phosphodiesterase 5
Ectonucleotide pyrophosphatase/phosphodiesterase family member 5
Ectopic P granules protein 4
ectosomes
ectoteloblasts
ectromelia poxvirus p13
Ectromelia virus A39R protein
Ectromelia virus CD30
Ectromelia virus chemokine binding protein
Ectromelia virus cytokine response modifier D
Ectromelia virus E12 protein
Ectromelia virus E13 protein
Ectromelia virus E163 protein
Ectromelia virus E184 protein
Ectromelia virus IL1-beta receptor
Ectromelia virus IL18BP
Ectromelia virus IL18 binding protein
Ectromelia virus K2R protein
Ectromelia virus N1L protein
Ectromelia virus p28 protein
Ectromelia virus serine protease inhibitor-2
ECTV N1L protein
EC-VMFb

ED1
ED2
ED3
ED4
EDA
EDA1
EDA1R
EDA2R
EDA-A1
EDA-A1R
EDA-A1 receptor
EDA-A2
EDAF
EDA-like cell death trigger
EDAR
EDARADD
EDAR-associated death domain
EDC34
EDCF
EDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF
EDDR1
EDDR2
EDEEMLLPAAAPDYADPMQSYWWYPSYAGYADLDWNDYRRAE
edema factor
EDENFILKHTGPGILSM
EDF
Edg
EDG1
EDG5
EDG6
EDGF
EDGF-1
EDGF-2
EDIL3
edin
EDIN
edited cancer cells
edited tumor cells
EDKPFWPPPIYPM
ED-LCA
EDMF
EDN
EDN1
EDN2
EDN3
eDNA
EDNAP
EDNH
EDNRA
EDNRB
EDP
EDP1
EDR
Edrecolomab
EDRMSLVDSRCQEA
EDTA-extractable protein 32 kDa 2
EdTx
educated platelets
EDVPSER

EE cells
EECs
EEDCK
EEDSG
EEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSL
EEEESRPRKLCGRHLLIEVIKLCGQSDWS
EEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRamidate
EEF1A
EEF1A1
EEF1A2
EEF1AL
EEF1A-like
EEF1A2/S1
EEF1E1
EEG1
EEG1L
EEG1S
EEIIMD
EEK
EEKTRFPKFMRWGamide
EEP 32-2
eEPCs
EETs

EF
EF1A
EF1-alpha
EF1-alpha-2
EF-1 peptide
EF-5
EF-10
Efb
Efb homologous protein
EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
EFEMP1
effector B-cells
effector caspases
effector cell protease receptor 1
Effector Memory T-cells
effector memory T-helper 17 cells
effector regulatory T-cells
effector T-cells
effector Th17 cells
effector Tregs
efferent neurons
efferocytes
efferocytosis
eFGF
EF-hand domain
EF-hand domain containing protein D2
EFHD2
EFNA1
EFNA2
EFNA3
EFNA4
EFNA5
EFNA6
EFNB1
EFNB2
EFNB3
EFP
EF-Tu

eGCs
EG cells
EGF
EGF-1
EGF-2
EGF-3
EGF binding protein
EGFBP
EGFBP2
EGF-BP B
EGF-CFC
EGF containing fibulin extracellular matrix protein 1
EGF-containing fibulin-like extracellular matrix protein 1
EGF-F
EGF family
EGFI
EGF-inducible protein 1
EGF inhibitor
EGFL
EGFL6
EGFL6-like
EGFL7
EGFL8
EGF-like-6
EGF-like-7
EGF-L domain
EGF-like cysteine-rich repeated motif
EGF-like domains
EGF-like domain 8
EGF-like domain containing protein-1
EGF-like domain containing protein-6
EGF-like domain containing protein-7
EGF-like module
EGF-like module containing mucin-like hormone receptor-like-1
EGF-like module containing mucin-like hormone receptor-like-2
EGF like domain multiple 8
EGF-like repeats
EGF-like repeats and discoidin I-like domains 3
EGF-like transforming growth factor
EGF module-containing mucin-like hormone receptor
EGFR
EGFR5
EGFR(293-294)
EGFR-coamplified and overexpressed protein
EGF receptor
EGF receptor 1
EGF receptor 2
EGF receptor 3
EGF receptor 4
EGF-receptor-binding peptide
EGF receptor-related inhibitor of cell growth
EGF receptor-related protein
EGF-related growth factors
EGF response factor 1
EGF response factor 2
EGFR-related protein
EGFR-specific transcription factor
EGF-TM7
EGF-URO
egg cells
egg development neurosecretory hormone
egg laying abnormal-1
egg laying abnormal-9
egg laying abnormal-15
egg laying abnormal-17
egg laying abnormal-20
egg-laying hormone
EGI
EGKPYWPPPFLPE
EGL-1
EGL-9
EGL-9 homolog 3
EGL-15
EGL-17
EGL-20
EGLHNYR
EGLN3
EGL nine homolog 3
EGP
EGP-2
EGP34
EGP40
EGP314
egr
Egr-1
Egr-2
Egr-3
Egr-4
EGR-alpha
EGR consensus box
EGRMYSFGLamide
EGSDTITLPCRIKQFINMWQE
EGSF
EgTeg
EG-VEGF
EGVNDNEEGFFSAR

EH
ehcp5
EH domain
EH domain/SH3 domain-containing protein
EHEC
Ehh
EHK2
Ehp
EHRF
EHSH1
EHS laminin
eHsp72
EHT
EHV-2 E1 orf
EHV-2 IL10
EHWSY
EHZF

EI
ei24
EIA
EIAV S2 protein
EICADPKQKWVQ
EIEC
EIELVEEEPPF
EIF
eIF-4D
eIF4-gamma-2
EIF5A
EIF5A1
EIF5A2
EIGDEENSAKFPIamide
Eiger
Eiger-L
Eiger-S
EINTVQV
EIP
EIP-1
EIPT
EISLDKD

EKA
EKA/B
EK-AF-1
EK-AF-2
EKB
EKC
EKC/D
EKD
EK-derived basophil promoting activity
EKGYSDCAWEIVRVEMMRALTSSTTLQKRLTKTGGDLNSP
E-kinin
EKKGFCAGY
ekkrinosiderophilin
EKLF
EKLFDGYQFGEDMSKENDPFIPPRamide
EKS3
EKVNELSK

EL4
EL4 6.1
EL4 B-cell growth factor
EL4-BCGF
ELA
ELABELA
Elafin
Elafin-like protein I
Elafin-like protein II
ELAM
ELAM-1
ELAM-1 ligand fucosyltransferase
ELANH2
Elastase inhibiting activity
elastase inhibitor
Elastase-specific inhibitor
Elastin
elastin-binding protein
Elastin binding protein-37
elastin-binding protein 67 kDa
elastin degradation products
elastin-derived peptides
elastin-like peptides
elastin-like polypeptides
Elastin microfibril interface located protein 3
Elastin microfibril interfacer 3
elastin-mimetic polypeptides
Elastin peptides
elastokines
ELAV
ELAVL1
ELAVL2
ELAVL3
ELAVL4
ELAV like RNA binding protein 1
ELAV like RNA binding protein 2
ELAV like RNA binding protein 3
ELAV like RNA binding protein 4
elav-type RNA-binding protein 3
ELC
ELCF
ElciRNAs
ELCs
ELDF
ELDIF
ELDLSYNKLK
Electric Cell Impedence Sensing of chemotaxis
Eledoisin
eleocytes
elevated during infection
Elevenin
elevenins
elevenin-Vc1
ELF-1
ELF-2
ELF-4
ELF-153-derived fibroblast growth stimulating activity
ELFADKVPKTAENFRAL
ELFT
ELH
ELINSW
ELISA
ELK
ELK-L
Elk-L3
ELK ligand
elk-related receptor ligand 3
ELK-related tyrosine kinase
ellipsoid body-protocerebral bridge gall neurons
ellipsoid body R-neurons
elliptocytes
ELLLNPTHQIYPVTQPLAPV
Elm1
ELM1 domain
ELMER
ELMO1
ELMO2
ELMO3
ELN
ELNFQHAFVamide
ELO blood group antigen
elongation factor 1-alpha
elongation factor 1-alpha-1
elongation factor 1-alpha-2
Elongation factor Tu
ELP
ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS
ELR
ELR Chemokines
ELRLPEIARPVPEVLPARLPLPALPRN
EL T-cell replacing factor
E-LTC-IC
elt-2
ELTFTPNWGTamide
EL-TRF
Elvax 40
ELVs

EM-1
EM-2
EM66
EMA
EMAP
EMAP-1
EMAP-2
EMB
Embigin
EMBP
Embryo-associated immunosuppressor factor
embryoblast
embryo-derived histamine releasing factor
embryo fibroblast protein 1
Embryogenin-1
embryoid bodies
embryoid body angiogenesis assay
embryoid body-derived cells
Embryokines
embryonal carcinoma cells
embryonal carcinoma-derived growth factor
embryonal stem cell gene 1
embryonal stem cells
embryonic carcinoma-derived growth factor
embryonic FGF
embryonic fibroblast growth factor
embryonic germ cells
Embryonic growth/differentiation factor
embryonic hemoglobin
Embryonic kidney-derived angiogenesis factor-1
Embryonic kidney-derived angiogenesis factor-2
embryonic lethal abnormal visual system
embryonic lethal abnormal vision
embryonic lethal abnormal vision homolog 1
embryonic lethal abnormal vision homolog 2
embryonic lethal abnormal vision homolog 3
embryonic lethal abnormal vision homolog 4
embryonic NCAM
embryonic neural cell adhesion molecule
embryonic OCT4A
embryonic octamer-binding protein 4A
Embryonic receptor kinase-2
embryonic stem cell-associated transcript 2
embryonic stem cell-associated transcript 3
embryonic stem cell-associated transcript 4
embryonic stem cell-associated transcript 5
embryonic stem cell-associated transcript 8
embryonic stem cell-associated transcript 9
embryonic stem cell-associated transcript 11
embryonic stem cell-associated transcript 15-1
embryonic stem cell-associated transcript 15-2
Embryonic stem cell chemokine
embryonic stem cell-expressed Ras
Embryonic stem cell growth factor
embryonic stem cell kinase
embryonic stem cells
embryonic vascular EGF-like repeat-containing protein
embryotrophic factor-1
embryotrophic factor-2
embryotrophic factor-3
embryotrophic factors
embryotrophins
embryotropins
EMC10
EMCV 2B protein
EMCV 2C protein
EMCV 3D protein
EMCV viroporin 2B
emergency granulopoiesis
emergency hematopoiesis
Emergency monocytopoiesis
emergency myelopoiesis
emetine resistance gene
EMF-1
EMH
EMI domain
Emilin 3
EMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQC
EML C1
EML cells
EMMPRIN
Emoctakin
Emp
EMP
EMP-1
EMP1
EMP2
EMP3
EMPB3
emperipolesis
emperitosis
EMPFPK
EMR1
EMR2
EmRK2
EMPs
EMSP1
EMT
emtB
EmtinB

EN1
EN2
ENA-78
Enabled/VASP homology 1 domain
enamel cells
enamel-forming cells
Enamel matrix serine proteinase 1
Enamelysin
eNampt
ENAP
ENAP-alpha
ENAP-beta
enarkyochrome cells
Enbocin
Enbocin2
Enbocin3
Enbrel
E-NCAM
Encamin A
Encamin B
Encamin C
Encamin D
Encamin E
Encamin F
Encamins
encephalic photoreceptor cells
Encephalomyocarditis virus 2B protein
Encephalomyocarditis virus 2C protein
Encephalomyocarditis virus 3D protein
Encephalomyocarditis virus viroporin 2B
Ende
EndMT
ENDO180
endoB
Endo B cytokeratin
endo-Calreticulin
EndoCAM
Endocan
endochondral ossification genetic factor
endocrine cells
endocrine FGFs
endocrine fibroblast growth factors
Endocrine gland-derived vascular endothelial growth factor
endocrine glands
Endocrine hormones
endo-CRT
endocycle
endocycling
endoderm
endoG
endogenous bioactive peptides
Endogenous Carboxypeptidase Inhibitor
endogenous erythroid colonies
Endogenous Ligand conferring MitogEnic Response
endogenous memory T-cells
Endogenous Peptide Inhibitor of CXCR4
endogenous siRNAs
endogenous small interfering RNAs
endogenous pyrogens
endogenous secretory RAGE
endoglin
EndoGlyx-1
Endokine
endokines
Endokinin A
Endokinin A/B
Endokinin B
Endokinin C
Endokinin C/D
Endokinin D
Endokinins
endolyn
endolyn-78
Endometase
Endometrial bleeding associated factor
endometrial cells
endometrial granular cells
endometrial granulated cells
endometrial granulocytes
endometrial NK-cells
endometrial protein 14
endometrial tumor-derived metalloproteinase
endometriotic cells
endomitosis
endomorphin-1
endomorphin-2
Endomorphins
EndoMT
endoneurial cells
endoneural cells
endoneurium
Endonexin-2
endonuclease G
endo-oligopeptidase A
EndoPDI
endopeptidase-2
endopeptidase 24.11
Endopeptidase 24.15
endopeptidase 24.16
endopeptidase-24.18
endopeptidase 24.15/16
endopeptidase 3.4.24.16
endopeptidases
Endophilin B1
endopinacocytes
endoplasmic reticulophagy
endoplasmic reticulum aminopeptidase 1
endoplasmic reticulum aminopeptidase associated with antigen processing
endoplasmic reticulum-associated apoptosis-involved protein containing PH and FYVE domains
endoplasmic reticulum-Golgi intermediate compartment protein-53
endoplasmic reticulum interferon stimulator
endoplasmic reticulum metallopeptidase 1
Endoplasmic reticulum resident protein 46
Endoplasmic reticulum-to-nucleus signaling 1
Endoplasmic reticulum-to-nucleus signaling 2
Endoplasmin
endoreduplication
Endorepellin
Endoreplication
Endorphin-alpha
Endorphin-beta
endorphinergic neurons
Endorphin-gamma
Endorphins
Endosialin
endo-siRNAs
Endosomal microautophagy
Endosome-associated ubiquitin isopeptidase
Endostar
Endostatin
Endostatin 15
Endostatin 18
Endostatin(60-70)
Endostatin(171-183)
Endostatin fragment
Endostatin fragment 2
Endostatin fragment 5
Endostatin peptide 30
Endostatin XV
endothelial and smooth muscle cell-derived neuropilin-like molecule
endothelial cell adhesion molecule
endothelial cell colony-forming units
Endothelial cell-derived growth factor
Endothelial cell-derived lymphocyte chemotactic activity
Endothelial cell growth factor-1
Endothelial cell growth factor-2a
Endothelial cell growth factor-2b
Endothelial cell growth factor-alpha
Endothelial cell growth factor-beta
Endothelial cell growth factor
Endothelial cell growth inhibitor
Endothelial cell growth supplement
endothelial cell growth-suppressing factor
Endothelial cell inhibitor
endothelial cell microparticles
Endothelial cell neutrophil-activating peptide-alpha
Endothelial cell neutrophil-activating peptide-beta
Endothelial cell neutrophil-activating peptide
endothelial cells
endothelial cell-selective adhesion molecule
endothelial cell-selective adhesion molecule-1
endothelial cell side population cells
endothelial cell-specific chemotaxis regulator
endothelial cell-specific chemotaxis receptor
endothelial cell-specific molecule 1
Endothelial cell-specific molecule 2
endothelial cell–specific molecule 3
endothelial cell spheroids
endothelial cell spheroid assay
endothelial cell sprouting
Endothelial cell stimulating angiogenic factor
endothelial cellular adhesion molecule
Endothelial cell-viability maintaining factor
endothelial cell viability maintaining factor b
Endothelial collagen
endothelial colony-forming cells
Endothelial derived growth factor
Endothelial-derived neutrophil-activating peptide
Endothelial-derived neutrophil chemotactic factor
endothelial differentiation gene 1
Endothelial differentiation G-protein-coupled receptor 1
Endothelial differentiation G-protein coupled receptor 5
Endothelial differentiation G-protein coupled receptor 6
Endothelial IL8
endothelial Krüppel-like Zinc finger protein
endothelial lectin HL-1
endothelial lectin HL-2
endothelial leukocyte adhesion molecule 1
endothelial lineage cells
endothelial-mesenchymal transformation
endothelial-mesenchymal transition
Endothelial-monocyte activating polypeptide
Endothelial-monocyte activating polypeptide-1
Endothelial-monocyte activating polypeptide-2
endothelial outgrowth cells
endothelial-overexpressed lipopolysaccharide-associated factor-1
endothelial phalanx cells
endothelial plasminogen activator inhibitor
endothelial progenitor cells
endothelial protein C receptor
endothelial protein-disulfide isomerase
endothelial sprouting
endothelial stalk cells
endothelial tip cells
endothelial TNF-alpha-induced protein 1
endothelial-to-hematopoietic transition
endothelial tube formation assay
Endothelin-1
Endothelin-1 receptor
Endothelin-2
Endothelin-3
Endothelin-beta
Endothelin-converting enzyme
Endothelin-converting enzyme 1
endothelin receptor type B-like protein
Endothelin B receptor-like protein 2
Endothelins
Endothelin type A receptor
Endothelin type B receptor
endotheliocytes
Endothelioma-derived motility factor
Endothelium-derived contracting factor
endothelium leukocyte adhesion molecule 1
endotoxin-neutralizing protein
endotoxin receptor
endotoxins
Endotrophin
ENDOU
endozepine
energy homeostasis associated
ENF
ENFAGGCATGYLRTADGRCKPTF
ENFAVGCTPGYQRTADGRCKPTF
ENFNGGCLAGYMRTADGRCKPTF
ENF peptide family
ENFSGGCAGYMRTPDGRCKPTFYQLIT
enfuvirtide
ENFVGGCATGFKRTADGRCKPTF
ENG
Eng-2a
Eng-2b
Eng-3
Engrailed
Engrailed-1
Engrailed-2
Engrailed-2a
Engrailed-2b
Engrailed-3
Engrailed homeobox 1
Engrailed homeobox 2
engram cells
EnGS
engulfment adaptor PTB domain containing 1
engulfment and cell motility gene-1
engulfment and cell motility gene-2
engulfment and cell motility gene-3
engulfment signals
enhanced at puberty 1
enhancer of rudimentary homolog
enhancer RNAs
Enhancers
Enhancer trap locus 2
Enhancing activity
Enhancing factors
ENHO
ENKAF
eNK-cells
enkelytin
Enkephalin A
enkephalinase
enkephalinase A
enkephalin convertase
enkephalin-dipeptidyl-carboxypeptidase
enkephalinergic neurons
Enkephalin neurons
ENO1
ENO2
ENOA
Enolase
Enolase-1
Enolase-2
Enolase-2(138-153)
Enolase-2(138-163)
Enolase-2(138-168)
Enolase-alpha
Enovin
ENP
ENPEP
ENPP1
ENPP2
ENPP2-beta
ENPP2-gamma
ENPP3
ENPP5
ENRAGE
ENREVPPGFTALIKTLRKCKII
Ent-1
Entactin
Entamoeba histolytica cysteine proteinase-5
enteric beta-Defensin
enteric glial cells
enteric gliocytes
enteric smooth muscle actin-gamma-2
Enterin A
Enterin B
Enterin C
Enterin D
Enterin E
Enterin F
Enterin G
Enterin H
Enterin I
Enterin J
Enterin K
Enterin L
Enterin M
Enterin N
Enterin O
Enterin P
Enterin Q
Enterin R
Enterin S
Enterins
Enterin T
enteroaggregative Escherichia coli
enteroblasts
enterochromaffin cells
enterochromaffin-like cells
enterocytes
enterocytic cells
Enteroendocrine cells
enteroendocrine K cells
enteroglucagon
enteroglucagon-2
enteroglucagon cells
enteroglucagons
enterohaemorrhagic Escherichia coli
enteroids
enteroinvasive Escherichia coli
Entero-Kassinin
enterokine
enteropathogenic Escherichia coli
Enterophilin-1
Enterostatin
enterotoxinogenic Escherichia coli
Enterovirus 2B protein
Enterovirus non-structural protein 2B
ENTH domain
Entosis
Entotic cell death
entotic cell-in-cell death
ENTPD1
ENTPD2
ENTPD3
ENTPD5
ENTPD6
Entsp-PVK-1
Entsp-PVK-2
Env-derived antiviral factor
ENX2
Enzyme-linked immunosorbent assays

Eo-CFC
EoCP-1
EoCP-2
EOCs
Eo-CSF
Eo-DF
eokines
EOLA1
eomyelocytes
eosinocytes
Eosinophil-activating factor
eosinophil-associated ribonuclease
eosinophil-associated ribonuclease-1
eosinophil cationic protein
eosinophil cationic protein-1
eosinophil cationic protein-2
eosinophil cationic protein(1-45)
eosinophil cationic protein(8-36)
eosinophil cationic protein(32-41)
eosinophil chemotacic activity
eosinophil chemotactic cytokine-L
eosinophil chemotactic factor of anaphylaxis
Eosinophil chemotactic polypeptide-1
Eosinophil chemotactic polypeptide-2
Eosinophil colony-forming cells
eosinophil colony-forming units
Eosinophil colony stimulating factor
Eosinophil cytotoxicity-enhancing factor
Eosinophil cytotoxicity inhibitor
Eosinophil differentiation activity
eosinophil-derived neurotoxin
Eosinophil differentiation factor
eosinophil-directed chemotactic inhibitory factor
eosinophil-directed chemotactic inhibitory factor releasing factor
Eosinophil extracellular traps
Eosinophil granule major basic protein
eosinophilic granulocytes
Eosinophilic leukemia cell differentiation factor
eosinophilic leukocytes
Eosinophilic myelocytes
eosinophilopoietin
Eosinophil protein X
eosinophils
eosinophil stimulating material
Eosinophil stimulation promoter
Eosinophil viability-enhancing activity
eosinopoietins
Eotaxin
Eotaxin-1
Eotaxin-2
Eotaxin-3
Eotaxin receptor

EP
Ep
Ep1.B
EP2
EPII cells
EP153R
EP402R
EP24.15
EP24.16
EP24.15/16
EPA
EPASGMM
EPB3
EPC-1
Ep-CAM
EPCR
EPCs
epd
EPDCs
EPDR1
EPECs
EPEC secreted protein F
ependymal cells
Ependymal pituicytes
Ependymal radial glial cells
Ependymin
ependymin-beta
ependymin-gamma
ependymin related 1
ependymin related protein 1
ependymoblasts
ependymocytes
EPF
EPF-induced suppressor factor-1
EPF-induced suppressor factor-2
EPFKLSLHLamide
EPF-S1
EPF-S2
EPG
epg-4
EPGN
E-PG neurons
EP-GP
EPH
EPH and ELK-related kinase
EphA1
EphA2
EphA3
EphA4
EphA5
EphA6
EphA7
EphA8
EphA9
EphA10
EphB1
EphB2
EphB3
EphB4
EphB5
EphB6
eph/elk-like tyrosine kinase
EPH homology kinase-2
Eph ligand family-1
Eph ligand family-2
Eph ligand family-4
Eph-like kinase
EPH-like tyrosine kinase
eph-like tyrosine kinase 1
Eph receptor A1
Eph receptor A2
Eph receptor A3
Eph receptor A4
Eph receptor A5
Eph receptor A6
Eph receptor A7
Eph receptor A8
Eph receptor A9
Eph receptor A10
Eph receptor B1
Eph receptor B2
Eph receptor B3
Eph receptor B4
Eph receptor B5
Eph receptor B6
Eph receptors
EPH-related receptor tyrosine kinase ligand-1
EPH-related receptor tyrosine kinase ligand-2
EPH-related receptor tyrosine kinase ligand-3
EPH-related receptor tyrosine kinase ligand-4
EPH-related receptor tyrosine kinase ligand-5
EPH-related receptor tyrosine kinase ligand-6
EPH-related receptor tyrosine kinase ligand-7
EPH-related receptor tyrosine kinase ligand-8
Ephrin A1
Ephrin A1a
Ephrin A1b
Ephrin A2
Ephrin A3
Ephrin A4
Ephrin A4 (s)
Ephrin A5
Ephrin A6
Ephrin B1
Ephrin B2
Ephrin B3
ephrins
EPI
epiblast
epiblast stem cells
Epibolin
Epican
epicardium-derived cells
epidermacan
epidermal cell-derived contra-IL1
Epidermal cell-derived granulocyte-activating mediator
Epidermal cell-derived lymphocyte chemotactic factor
Epidermal cell-derived lymphocyte differentiating factor
Epidermal cell-derived NK augmenting factor
Epidermal cell-derived thymocyte activating factor
epidermal cell differentiation inhibitor
Epidermal cell IL3
epidermal dendritic cells
Epidermal growth factor
Epidermal growth factor binding protein
Epidermal growth factor-binding protein 2
Epidermal growth factor-binding protein type B
epidermal growth factor family
Epidermal growth factor-like cripto protein
Epidermal growth factor-like cripto protein CR3
epidermal growth factor-like domain multiple 7
Epidermal growth factor-like protein 8
epidermal growth factor receptor 1
epidermal growth factor receptor 2
epidermal growth factor receptor 3
epidermal growth factor receptor 4
Epidermal growth factor receptor 5
epidermal growth factor receptor-associated protein with SH3 and TAM domains
epidermal growth factor receptor-related inhibitor of cell growth
Epidermal inhibitory pentapeptide
epidermal intercellular proteoglycan
Epidermal keratinocyte-derived basophil promoting activity
Epidermal lymphocyte chemotactic factor
Epidermal Lymphoid Cells
epidermal pentapeptide
epidermal plasminogen activator inhibitor
epidermal proliferating units
epidermoblasts
epididymal apical protein I
epididymal proteinase inhibitor
Epididymal secretory protein 13.6
epididymosomes
Epidermis-specific secreted protein SK30/SK89
Epidermis-specific secreted protein sk89
epididymal proteinase inhibitor-1
epididymal proteinase inhibitor-2
epididymal proteinase inhibitor-3
Epididymal secretory protein E5
Epididymal secretory protein 13.2
epididymis protein-2
epididymis-specific clone 6
Epididymis-specific clone 42
Epigen
epigenetic control of gene expression
epigenetic memory
EPIL
Epilepsy, progressive myoclonic 1
epiligrin
Epilysin
Epim
Epi-microRNAs
Epi-miRNAs
Epimorphin
Epinecidin-1
epineurial cells
epineural cells
epineurium
Epiplexus cells
epiplexus macrophages
Epiregulin
epiSCs
episialin
Epitaxin
Epitempin
epithelial cadherin
epithelial CD44
epithelial cell adhesion molecule
epithelial cell-derived neutrophil attractant-78
epithelial cell growth inhibiting factor
epithelial cell inflammatory protein-1
Epithelial cell kinase
epithelial cell rests of Malassez
epithelial cells
epithelial cell-specific growth inhibitor
epithelial cellular adhesion molecule
epithelial discoidin domain receptor 1
epithelial discoidin domain receptor 2
epithelial glycoprotein
epithelial glycoprotein-2
epithelial glycoprotein 34
epithelial glycoprotein 40
epithelial growth inhibitor
Epithelial Membrane Antigen
epithelial membrane protein-1
epithelial membrane protein-2
epithelial membrane protein 3
epithelial-to-mesenchymal interactions
epithelial-to-mesenchymal transdifferentiation
epithelial-to-mesenchymal transformation
epithelial-to-mesenchymal transition
epithelial-to-mesenchymal transition type 2
epithelial mitogen
Epithelial neuronotrophic factor
Epithelial neutrophil-activating protein 78
Epithelial rests of Malassez cells
epithelial reticular cells
epithelial root sheath cells
epithelial surface antigen
Epithelial transforming growth factor
Epithelin-1
Epithelin-2
Epithelins
epitheliocytes
epithelioid cells
epithelioid histiocytes
epithelioid macrophages
epitheliotrophins
epiviosamines
Epizootic haematopoietic necrosis virus CARD protein
Epl1
EPLG1
EPLG2
EPLG3
EPLG4
EPLG5
EPLG6
EPLG7
EPLG8
EPLIN
EPLM cells
EPM
EPM1
Epo
epoetin
Epoetin alfa
Epogen
EPO mimetic peptide 1
EPOR
EPO-X4
EPP
EPPGGSKVILF
Eppin
Eppin-1
Eppin-2
Eppin-3
EPR
EPR1
EPRAP
EPRS
Eps15 homology domain
EPSC
epsilon bag cell peptide
epsilon-BCP
Epsilon BP
Epsilon cells
Epsilon globin
Epsilon-Interferon
epsin NH2-terminal homology domain
Epstein-Barr virus BALF-1 protein
Epstein-Barr virus BamHI-A rightward frame 1
Epstein-Barr virus BARF0 protein
Epstein-Barr virus BARF1
Epstein-Barr virus BCRF-1
Epstein-Barr virus BGLF5
Epstein-Barr virus BHRF-1
Epstein-Barr virus BILF1 protein
Epstein-Barr virus BLLF3 protein
Epstein-Barr virus BNLF2a protein
Epstein-Barr virus BPLF1 protein
Epstein-Barr virus BZLF1 protein
Epstein-Barr virus BZLF2 protein
Epstein-Barr virus dUTPase
Epstein-Barr virus glycoprotein 42
Epstein-Barr virus gp42 protein
Epstein-Barr virus induced gene 1
Epstein-Barr virus induced gene 1 ligand
Epstein-Barr virus induced gene 3
Epstein-Barr virus induced gene 6
Epstein-Barr virus inducing factor
Epstein-Barr virus latent membrane protein 2A
Epstein-Barr virus nuclear antigen-5
Epstein-Barr virus nuclear antigen leader protein
Epstein-Barr virus p55-DNAse
Epstein-Barr virus receptor
Epstein Barr virus RTA
Epstein-Barr virus small RNA-associated protein
Epstein-Barr virus SM protein
Eptotermin alfa
EPTWNNLKGMWamide
EPUs
EPX

Eq-1
EQAINRAGIVQEDVQPPGLKVWSDPFamide
EQEELENYIEHVLLHRP
EQFDDYGHMRFamide
EQFEDYGHMRFamide
EQKQLQ
EQLTK
Equarin
equiluminance cells
equine chorionic gonadotropin
Equine herpesvirus 2 open reading frame E1
equine herpesvirus FLICE-inhibitory protein
equine herpesvirus glycoprotein G
equine herpesvirus type 1 glycoprotein G
Equine herpesvirus type 1 US3 protein
equine herpesvirus type 2 E8 protein
equine herpesvirus type 2 EHV-2 IL10
Equine herpesvirus UL3 protein
Equine infectious anemia virus S2 protein

ER-37
ERAAP
ERAP1
ERAS
ER autophagy
erb
erbA
erbB
erbB1
erbB2
erbB2 interacting protein
erbB2IP
erbB3
erbB4
ERBB receptor feedback inhibitor 1
Erbin
ER-binding fragment-associated antigen-9
Erbitux
Erbstatin
ERC
ERC/mesothelin
ERCs
ER-D5 antigen
ERDMHRFSFGLamide
ERDR1
EREG
Erf-1
ERF1
Erf-2
ERFE
ERGIC-63
ER-Golgi intermediate compartment protein-53
ERGs
ERH
ERICE
Erik blood group antigen
ERILSILRHQNLLKE
Eriocheir sinensis Anti-lipopolysaccharide factor
Eriocheir sinensis Anti-lipopolysaccharide factor 1
Eriocheir sinensis Anti-lipopolysaccharide factor 2
Eriocheir sinensis double WAP domain containing protein
Eriocheir sinensis Lectin D
ERIS
ERK
ERK1
ERK2
ERK1/2
ERK/MAPK signalling
ERK pathway
ERK signalling
ER membrane protein complex subunit 10
ERMAP
ERM cells
ERM homology domain
ERMP1
ER-MP12
ERN1
ERN2
eRNAs
Erns
E-rosette receptor
erp
ERp46
ERp99
ER-phagy
ERPhPSLKTRFamide
ER protein 46
ER protein 99
ERRFI1
ERRP
ERT
ERTESIIHRALYYDLIS
ERV1
erv1-like growth factor
eryptosis
eryptotic death
erythroblastic islands
erythroblast macrophage protein
erythroblast membrane-associated protein
erythroblasts
Erythrocyte colony stimulation factor
Erythrocyte-derived growth-promoting factor
erythrocyte chemokine receptor
erythrocyte ghosts
erythrocyte membrane protein band 3
Erythrocyte plasma membrane 50 kDa glycoprotein
erythrocyte receptor
erythrocytes
erythroferrone
Erythroid burst promoting activity
erythroid burst stimulating activity
erythroid cells
Erythroid colony stimulating activity
erythroid colony-forming cells
erythroid colony-forming units
Erythroid colony stimulating factor
Erythroid differentiation factor
Erythroid differentiation regulator
Erythroid differentiation regulator 1
erythroid expressed gene-1
erythroid Krüppel-like factor
Erythroid-like transcription factor family 2
Erythroid potentiating activity
Erythroid potentiating factors
erythroid progenitor cells
Erythroid promoting activity
erythroid protein band 3
erythroid suppressor cells
erythromyeloid progenitors
erythrophages
erythrophagocytes
erythrophagocytosis
erythrophore
erythropoiesis
Erythropoiesis stimulating factor
Erythropoietic factor
Erythropoietin
erythropoietin helix B-surface peptide
Erythropoietin-producing hepatocellular carcinoma receptors
Erythropoietin-producing hepatoma receptors
Erythropoietin-responsive cells
erythrosomes

ES18
ES-2 peptide
ES-43
ESA
Es(a) antigen
ESAF
EsALF
EsALF-1
EsALF-2
ESAM
ESAM-1
ESCs
ESC6
ESC42
Escapin
ESC-CEB derived endothelial cell growth factor
ES cell-associated transcript 2
ES cell-associated transcript 3
ES cell-associated transcript 4
ES cell-associated transcript 5
ES cell-associated transcript 8
ES cell-associated transcript 9
ES cell-associated transcript 11
ES cell-associated transcript 15-1
ES cell-associated transcript 15-2
ES cell differentiation inhibitory activity
ES cell-expressed Ras
ES cell growth factor
ES cells
ESCGF
Escherichia coli
Escherichia coli attaching and effacing
Escherichia coli Cytolethal distending toxin
Escherichia coli elongation factor-G
Escherichia coli-secreted protein F
Escherichia coli-secreted protein J
Escort cells
ES-CRISP
Esculentin
Esculentin-1
Esculentin-1b
Esculentin-1c
esculentin-1GN
esculentin-1ISa
esculentin-1ISb
Esculentin-2
Esculentin-2CHa
esculentin-2EM
esculentin-2ISa
Esculentin 1-21
Esculentin-1(1-18)
esculentins
ESDN
ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW
EsDWD
Ese1
ESEL
E-selectin
E-selectin ligand-1
ESF
esg-1
ESI
esiRNAs
ESIVRPPPVEAKVEETPE
Esk
ESkine
ESL-1
EsLecD
ESM
ESM-1
ESMD
ES-OMC-MN
ESOP-1
ES-OP9 coculture clone 1
esophageal cancer-related gene 4
ESP
ESP13.2
ESP13.6
espF
EspJ
esRAGE
esRNA
ESRRBL1
essential for respiration and viability 1
EST
EstA
established cell line
estrogen receptor-binding fragment-associated antigen 9
estrogen receptor binding site associated antigen 9
estrogen receptor factor 1
estrogen receptor-related protein
estrogen-regulated protein 24K
Estrogen-related receptor beta-like protein 1
Estrogen-responsive finger protein
estromedins

ET
ET-1
ET-2
ET-3
ET-1(1-21)
ET-1(1-31)
ETA
Eta-1
ETAF
Etanercept
ETAPLSTMLSPY
ETAR
ET(A) receptor
ETB
et blah cetera
ETBR
ET(B) receptor
ET(B)R-LP
ET(B)R-LP-2
ET-cells
ETEC
ETF
ETF-1
ETF-2
ETF-3
ETFLSTNKLENQ
ETH
ETH1
ETH2
ETH-AP
ETH-associated peptide
ETHE1
ETHR
ETHR-A
ETHR-B
ETH receptor
ETH receptor A
ETH receptor B
ethylmalonic encephalopathy 1
ETIQLQPTQGILIPAPLAENIRVS
ETK
ETK1
Etl2
etoposide-induced 2.4 mRNA
Etoposide-induced protein 2.4 homolog
ETosis
ETP
ETPs
ETPDCFWKYCV
ETR3
ETR101
ETR103
ETRA
ETRB
eTregs
ETS1-associated protein 2
Ets variant gene 6
ETV6

eukaryotic cells
Eukaryotic elongation factor 1A1
Eukaryotic elongation factor 1A2
eukaryotic initiation factor 4D
Eukaryotic initiation factor 5A
Eukaryotic initiation factor 5A1
Eukaryotic initiation factor 5A2
eukaryotic translation elongation factor 1-alpha-1
eukaryotic translation elongation factor 1-alpha-2
eukaryotic translation elongation factor 1 epsilon 1
eukaryotic translation initiation factor-4-gamma-2
Eumenitin
eumenitin-F
eumenitin-R
Eurocin
eurydendroid cells
eurydendroid neurons

E(var)3-93D
EVASFDKSKLK
Evasin-1
Evasin-3
Evasin-4
Evasins
EV-associated extracellular RNAs
EVDB
EVDEEEEEG
EVEC
Evening cells
Evening neurons
Evenness interrupted
EVH1 domain
EVHHQKLVFF
Evi
EVI2B
Evi9
Evi9a
Evi9b
Evi9c
Evi27
EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
EVM139
EVN
EVNAKSPFGQRSPAHKQAAYHGMHHAQN
EVNFTPNWamide
Evolutionarily Related Interleukin-1-beta Converting Enzyme
EVR1
EVR2
EVR4
EVR5
EVs
EVTs
EVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQR
EVYVVAENQQGKSKA

EWI-2
EWI-2wint
EWI-2 without its N-terminus
EWI-101
EWI-F
EWI motif-containing protein 2
EWI motif-containing protein 101
EWI motif-containing protein F
EWKLPDLIINHITLTRRNCFKYRCG
EWQTDNCETCTCYET

Ex-1
Ex-2
Ex-3
Ex-4
excitatory amino acid carrier 1
excitatory amino acid carrier 2
Excitatory amino acid transporter 3
excitotoxic cell death
excitotoxicity
Exdpf
executioner caspases
Exenatide
Exendin-1
Exendin-2
Exendin-3
Exendin-4
Exendin-(1-30)
Exendin-(9-39)
Ex-FABP
Exhausted B-cells
exhausted cells
exhausted-like ILC2s
exhausted-like innate lymphoid type 2 cells
exhausted MBCs
exhausted memory B-cells
exhausted progenitor T-cells
Exhausted T-cells
exILC2s
exILC3s
ex-myomiRs
Exo1
EXOC3L3
exocyst complex component 3-like 3
exocrine cells
exocrine differentiation and proliferation factor
exocrine glands
Exocrine hormones
Exodus
Exodus-1
Exodus-2
Exodus-3
exogenous small interfering RNAs
exomiR receptors
exomiRs
exon 1A-tissue factor
exonic circRNAs
exon-intron circular RNAs
exons
exopeptidases
exorphin A4
exorphin A5
exorphin B4
exorphin B5
exorphin C
exorphins
Exopinacocytes
exopinacodermocytes
EXOSC5
exo-siRNAs
Exosomal miRNA receptors
Exosomal miRNAs
exosomal RNAs
exosomal shuttle RNA
exosome component 5
exosome-like vesicles
exosomes
exostoses (multiple)-like 3
exostosin-like 3
Exp2
expandable hemangioblasts
ExPEC
explant cultures
explanted cells
explants
Exportin-2
expressed in low-metastatic cells
expressed in renal carcinoma
Expressed mainly in T-cells
expressed sequence tag
Expression library
exRNAs
Exsulin
extended FMRFamides
extended long-term culture-initiating cells
extended PX domain
Externally regulated phosphatase
external tufted cells
extinction neurons
EXTL3
EXTR1
extraadrenal chromaffin cells
extracellular chromatin traps
extracellular CIRP
Extracellular complement-binding protein
Extracellular DNA
extracellular DNA traps
extracellular DING from CD4 T-cells
extracellular fatty acid-binding protein
Extracellular fibrinogen-binding protein
extracellular matrix
extracellular matrix metalloproteinase inducer
extracellular matrix protein 1
extracellular matrix protein 2
extracellular matrix protein-binding protein
extracellular matrix receptor-1
extracellular matrix receptor-2
extracellular matrix receptor-3
extracellular matrix receptor-6
Extracellular mitochondrial DNA
Extracellular myomiRs
extracellular newly identified RAGE-binding protein
Extracellular RNAs
extracellular signal-regulated kinase 1
extracellular signal-regulated kinase 2
extracellular signal-regulated kinase 1/2
extracellular signal-regulated kinase pathway
extracellular signal-regulated kinases
extracellular trap cell death
extracellular traps
extracellular vesicle-associated extracellular RNAs
extracellular vesicles
extracortical (non-plate) neurons
extraembryonic endoderm precursor cells
extraembryonic endoderm stem cells
extraglomerular mesangial cells
extraintestinal pathogenic Escherichia coli
extramedullary hematopoiesis
Extraparotid Glycoprotein
extravillous trophoblasts
EXT-related protein 1
extrinsic pathway inhibitor
extrinsic apoptosis
exudative vitreoretinopathy 1
exudative vitreoretinopathy 2 protein
Exudative vitreoretinopathy 4
exudative vitreoretinopathy-5

EYE001
Eye-derived growth factor
Eye-derived growth factor-1
Eye-derived growth factor-2
eye/head-velocity neurons
Eyk
Eylea

EZF



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001.