EDC34 |
EDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF |
chemokine receptor expressed in activated monocytes |
||
[Endothelium-derived contracting factor] This factor is isolated from conditioned medium of cultured endothelial cells (Kickey et al, 1985). It is identical with ET (endothelins) (Lüscher et al, 1992).
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |