estromedins |
ET-1 |
Leu-Glu-Ala-Asp-aldehyde |
||
ALTERNATIVE NAMES
EDCF [endothelium-derived contracting factor]. See also: individual entry for further information.
SOURCES
Endothelins are produced and secreted by endothelial cells and epithelial cells. ET-1(1-31) (CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY), a peptide derived from the 38 amino acid big endothelin precursor, is a major endothelin derivative that is a potent chemotactic peptide for human neutrophils and monocytes (Cui et al, 2001).
The synthesis of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |