Ear sponge assay |
EASPRVSRRYGRPFGGRPFVGGQFGGRPGCVCIRSPCPCANYG |
human embryo kinase-8 |
||
[Embryo-associated immunosuppressor factor] A biochemically uncharacterized factor of 24 kDa found in the conditioned medium of choriocarcinoma cells. The factor is produced also by pre-implantation embryos and by decidual cells and trophoblasts. EASF is isolated from embryo growth media of in vitro fertilized human ova.
The factor is involved in pre-embryonic development after in vitro fertilization and possesses immunosuppressive activity.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |