EDAR-associated death domain |
EDCF |
Calcitonin gene-related peptide neurons |
||
This bioactive peptide (EDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF) is derived from the C-terminus of the matrix-associated serine protease inhibitor TFPI-2 [tissue factor pathway inhibitor-2] by cleavage with neurtrophil elastase (Papareddy et al, 2012). TFPI-2 is present in fibrin of wounds and is expressed also in skin, where it is up-regulated upon wounding. The fragment binds to bacteria and bacterial lipopolysaccharide, and induces bacterial permeabilization. The peptide also induces leakage in artificial liposomes. EDC34 shows antibacterial activity against both Gram-negative bacteria and Gram-positive bacteria in physiological buffer conditions.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |