EDC34

This bioactive peptide (EDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF) is derived from the C-terminus of the matrix-associated serine protease inhibitor TFPI-2 [tissue factor pathway inhibitor-2] by cleavage with neurtrophil elastase (Papareddy et al, 2012). TFPI-2 is present in fibrin of wounds and is expressed also in skin, where it is up-regulated upon wounding. The fragment binds to bacteria and bacterial lipopolysaccharide, and induces bacterial permeabilization. The peptide also induces leakage in artificial liposomes. EDC34 shows antibacterial activity against both Gram-negative bacteria and Gram-positive bacteria in physiological buffer conditions.

... ... ... ...
 
... CONTINUE READING at cells-talk.com, COPE's new home with 61 100+ entries, 141 552 cited references and >2,5 million internal hyperlinks. This most comprehensive knowledge base provides extensive in-context information covering nomenclature, terminology, and highlighting concepts, strategies & complexities of cellular communication processes. COPE's fully integrated subdictionaries include Dictionary of Angiogenesis • Dictionary of Antimicrobial & host defense peptides • Dictionary of Apoptosis and cell death • Dictionary of CD antigens • Dictionary of Chemokines • Dictionary of Cryptides • Dictionary of Cytokines & Growth factors • Dictionary of Eukaryotic cell types & expression profiles • Dictionary of Hematopoiesis • Dictionary of Hormones • Dictionary of Inflamation & inflammatory mediators • Dictionary of Innate Immunity • Dictionary of Metalloproteinases • Dictionary of Moonlighting proteins & cryptides • Dictionary of Neuropeptides • Dictionary of Pathogenicity & Virulence Factors • Dictionary of Pattern recognition receptors • Dictionary of Protein domains • Dictionary of Regulatory peptide factors • Dictionary of Viroceptors • Dictionary of Virokines • Dictionary of Stem cells and more.
 
An important note about your privacy: A search engine may have brought you here. If the provided URL differs in any way from "www.copewithcytokines.org/cope.cgi?key=search term", 3rd parties may record your activities on COPE. Bypass snoopers by doing this: Go directly to cells-talk.com or go to copewithcytokines.org in a new browser tab and from there explore whether COPE contains the terms that interest you. The private bioinformatics initiative COPE at cells-talk.com never shares your search histories or user databank entry with 3rd parties.

Copyright © 1997-2025. All rights reserved by Dr H Ibelgaufts, the sole author/owner/maintainer of the COPE Knowledge Base. EXPLICITLY: COPE's contents are strictly for the personal use of subscribers. They aren't in the public-domain and may not be reproduced elsewhere or transmitted in any form!

Entry last modified: June 2014