ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS |
ELR Chemokines |
dual-function chemokines |
||
A conserved sequence motif (Glu-Leu-Arg motif; glutamic acid-leucine-arginine) observed in a variety of chemokines (e. g., IL8, GRO-alpha, GRO-beta, GRO-gamma, NAP-2, ENA-78, GCP-2). The ELR sequence immediately precedes the first cysteine residue near the amino-terminal end and is critical for receptor binding and an essential motif for chemotactic activity. The ELR tripeptide sequence near the N-terminus of IL8 constitutes the primary receptor binding site (Gerber et al, 2000; Clark-Lewis et al, 1991).
Chemokines possessing this sequence generally belong to the subgroup of CXC-Chemokines
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |