Endokinin D |
endolyn |
Duffy Antigen Receptor for Chemokines |
||
The four endokinins, Endokinin A (abbr. EKA; DGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLM), Endokinin B (abbr. EKB; DGGEEQTLSTEAETWEGAGPSIQLQLQEVKGKASQFFGLM), Endokinin C (abbr. EKC; KKAYQLEHTFQGLLamide), and Endokinin D (abbr. EKD; VGAYQLEHTFQGLLamide), are members of the family of neuropeptides termed tachykinins. They are encoded by a single gene TAC4 [tachykinin-4] gene, which is expressed primarily in the adrenal gland and in the placenta.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |