Extracellular fibrinogen-binding protein |
extracellular matrix metalloproteinase inducer |
CIANRNGCQPDGSQGNCCSGYCHKEPGWVAGYCR |
||
abbr. ECM. The extracellular matrix occupies the space between cells. Many of the components of the extracellular matrix are connected to proteins of the cytoskeleton by transmembrane proteins.
The matrix is a complex network of different combinations of collagens, proteoglycans (PG), hyaluronic acid, laminin, fibronectin, and many other glycoproteins including proteolytic enzymes involved in degradation and remodeling of the extracellular matrix.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |