Exendin-3 |
Exendin-(1-30) |
Ranatuerin-2AMa |
||
abbr. Ex-4. This protein of 39 amino acids (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS) has been isolated from the venom of the lizard Heloderma suspectum (Gila monster) (Eng et al, 1992). A mammalian homolog does not seem to exist (Pohl and Wank, 1998). Exendin-4 shares 53 % identity at the amino acid level with that of the mammalian hormone GLP-1 [glucagon-like peptide-1] (Chen and Drucker, 1997). Exendin-4 is encoded within a prohormone that is distinct from the prohormone encoding glucagon. Using transgenic mice expressing exendin-4, Adatia et al (2002) have shown that mammalian cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |