Evi9c |
EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA |
Lipasin |
||
[ecotropic viral integration site 27] Evi27 has been identified as a common site of retroviral integration in BXH2 murine myeloid leukemias. Proviral integration results in increased expression of the Evi27 protein on the cell surface. Multiple Evi27 isoforms are detected in mice and humans.
Evi27 protein shows homology to the IL17 receptor (Tian et al, 2000). Some of the isoforms are most likely secreted forms of the receptor. Evi27 has been identified as the receptor for IL17B and IL17E. The receptor has been termed IL17 receptor homolog-1 (IL17Rh1) by Lee et al (2001).
In the mouse
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |