epigenetic memory |
Epilepsy, progressive myoclonic 1 |
Procalcitonin |
||
[early placenta insulin-like peptide] This protein is known also as placentin. The gene symbol is INSL4 [insulin-like-4] (see also: relaxin-like peptide family) (Koman et al, 1996). Like insulin, the hormone undergoes proteolytic processing from a propeptide in which a peptide resembling C-peptide located between the two hormone chains is removed to yield the A-chain (Early placenta insulin-like peptide A chain; SGRHRFDPFCCEVICDDGTSVKLCT) and the B-chain (Early placenta insulin-like peptide B chain; AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWL) of the mature hormone.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |