EPII cells |
EP402R |
SLFSLIKAGAKFLGKNLLKQGAQYAACKVSKEC |
||
[African swine fever virus EP153R] This open reading frame in the genome of African swine fever virus (ASFV) encodes a nonessential protein that has been involved in the hemadsorption process induced in virus-infected cells. EP153R encodes a C-type lectin homolog. The protein partically protects infected cells against cell death by apoptosis. Increased levels of caspase-3 and cell death is observed in cells infected with a virus deletion mutant lacking the EP153R gene, we have detected, in several virus-sensitive cells (Hurtado et al, 2004).
For other entries pertaining to cell death mechanisms see also the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |