EC3.4.24.23 |
EC3.4.24.35 |
CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPSYPG |
||
This enzyme is identical with 72 kDa gelatinase, 72 kDa metalloproteinase, collagenase type 4; collagenase type 4A, 72 kDa type IV collagenase, Gelatinase 72 kDa, Gelatinase A, Type IV collagenase, Type IVA collagenase, neutrophil gelatinase (see: MMP-2).
For other entries pertaining to metalloproteinases see also the Metalloproteinase Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |