EDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF |
EDDR2 |
signal sequence trap-derived clone 4 |
||
[epithelial discoidin domain receptor 1] EDDR1 is a protein receptor tyrosine kinase isolated from a cDNA library of SKOV-3, an epithelial ovarian cancer cell line. The receptor is expressed in epithelial cells of several tissues (Laval et al, 1994; Shelling et al, 1995).
EDDR1 is identical in all respects with DDR1 except for the presence of an additional exon (47 amino acids) in the juxtamembrane domain of DDR1 (Laval et al, 1994; Playford et al, 1996). Another splice variant, designated EDDR2, is generated because of a cryptic splice acceptor site that results in an extra 18 bp (6 amino acids) inserted 5' of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |