EMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQC |
EML cells |
Coxsackie B3 virus 2B protein |
||
referred to also as EML cells. A cell line derived from murine lymphohematopoietic progenitors immortalized by transformation with a recombinant retroviral vector harboring a dominant-negative retinoic acid receptor (Tsai et al, 1994). Proliferation of these cells is dependent on SCF (see also: Factor-dependent cell lines).
capable of differentiation into erythroid cells, myeloid cells, and lymphoid cells and are thought to represent a reliable and authentic model of hematopoietic progenitor lineage commitment and differentiation (Du et al, 2002; Ma et al, 2002; Pawlak et al, 2000; Tsai et al, 1993). The EML C1
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |