COPE Media Kit


Cope Home
Previous entry:
epineural cells
Next entry:
Epiplexus cells
Random entry:
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
Search COPE:

epineurium

A term for the connective tissue cell layers (epineurial cells or epineural cells) forming the outermost layer of peripheral nerves. Frequently, two anatomical portions can be distinguished, depending upon whether nerve trunks contain single or multiple nerve fascicles. The inner epineurium surrounds individual nerve fascicles and is itself surrounded by a second layer, the outer epineurium (Thomas, 1963; Thomas and Olsson, 1985; Peters et al, 1991). The term epineurium thus may refer to both anatomical portions and the cells contained therein.

The epineurial layers, like those of the perineurium and endoneurium, provides structural support and biomechanical protection for nerve fascicles, may act as a diffusion barrier, and also contains blood vessels and ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: March 2007



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=17541