ribosomal protein L30 |
ribosomal protein L32 |
NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK |
||
abbr. RPL31. This protein is a component of the 60S subunit of ribosomes (60S ribosomal protein L31) (Kenmochi et al, 1998). For gene structure see also: Yoshihama et al (2002).
Role as moonlighting protein
Apart from its role as a structural component of the 60S ribosome subunit, ribosomal protein L31 has another function and thus can be regarded as a member of a growing group of proteins referred to as moonlighting proteins. This protein has been identified as Chondromodulin-3 (see: Chondromodulin).
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |