COPE Media Kit

Cope Home
Previous entry:
rat O-acetyl ganglioside synthase
Next entry:
Random entry:
Drosophila melanogaster Diptericin
Search COPE:


Rattin from rat is a peptide of 38 amino acids (MAKRGFNCLLLSISEIDLPVKRLESPNKTRRPYGASIY) showing 73% identity in the conserved region to Humanin. Significant expression is seen in the central nervous system and in cardiac and skeletal muscle. Gottardo et al (2014) have reported expression of Rattin in the anterior pituitary of female and male adult rats as well as in pituitary tumor GH3 cells. Rattin is localized in lactotropes and somatotropes. Its expression is lower in females than in males, and is inhibited by estrogens in pituitary cells from both ovariectomized female and orquidectomized male rats. The expression of Rattin in pituitary tumor cells is not regulated by estrogens.

... ... ... ... ... Subscribe to continue reading! ... ...


Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at

See example pages at the bottom of the home page
The others just sisyphos around


Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia


SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions

U L T R A   P O S S E    N E M O   O B L I G A T U R

cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=43174