RSGRGECRRQCLRRHEGQPWETQECMRRCRRRG |
RSLQDTEEKSRSFSASQADPLSDPDQMNED |
Gamma-hemolysin AB |
||
This peptide with the sequence VQKDVSQRSIY (Val-Gln-Lys-Asp-Val-Ser-Gln-Arg-Ser-Ile-Tyr) is a bioactive fragment of semenogelin-1.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |