reticulon 4 receptor-like 2 |
reticulum cells |
NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK |
||
[endoplasmic reticulophagy]; also: ER-phagy, ER autophagy. This term has been used for a type of selective autophagy that is important for endoplasmic reticulum homeostasis. The term refers to the selective engulfment of aggregate-containing and/or damaged endoplasmic reticulum fragments for lysosomal degradation.
Studies in yeast where the perinuclear ER is equivalent to the nuclear envelope, have shown that the autophagy protein ATG39, which binds ATG8, specifically localizes to this region and induces autophagic sequestration of double-membrane vesicles that encapsulate intranuclear components. The ATG39-dependent pathway has been called nucleophagy
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |