rasp |
RAS p21 protein activator |
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
||
[regeneration associated serpin-1] rasp1 cDNA was isolated by differential hybridization from regenerating liver tissues obtained after hepatectomy. rasp1 is expressed in normal liver and its expression is upregulated after hepatectomy (New et al, 1996).
rasp1 encodes a secreted protein of 436 amino acids, which shows moderate homology with several members of the serpin family of serine protease inhibitors. The 1.7 kb rasp1 mRNA is not expressed in brain, heart, kidney, lung, testis or spleen. The protein is found in normal plasma and plasma obtained from hepatectomized rats (New et al, 1996).
The protein has been identified independently as ZPI [PZ-dependent protease inhibitor
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |